Recombinant Desulfotalea psychrophila Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Taxonomic Classification and Habitat

Desulfotalea psychrophila is a marine sulfate-reducing delta-proteobacterium isolated from permanently cold Arctic sediments off the coast of Svalbard at 79°N, 11°E. As the type strain of the genus Desulfotalea, D. psychrophila strain LSv54 (DSM 12343) is characterized by its remarkable ability to grow at temperatures as low as -1.8°C, with an optimal growth temperature of 10°C and a doubling time of approximately 27 hours during growth with lactate . These bacteria represent abundant members of microbial communities in Arctic marine sediments, where they play significant roles in the global carbon and sulfur cycles .

Genomic Architecture

The genome of D. psychrophila consists of a 3,523,383 base pair circular chromosome containing 3,118 predicted genes, complemented by two plasmids of 121,586 bp and 14,663 bp . The genomic analysis reveals distinct features that differentiate this psychrophilic bacterium from other sulfate reducers. The origin and terminus of replication are located at 72.4° and 231.4° respectively on the circular chromosome, with evidence for the postulated origin of replication (oriC) derived from the minimum of the cumulative G+C skew and the proximity of several DnaA binding sites .

Metabolic and Regulatory Systems

D. psychrophila possesses unique metabolic characteristics including TRAP-T (tripartite ATP-independent periplasmic transport) systems for the uptake of C4-dicarboxylates, unexpected genes from the TCA cycle, and a Twin-Arginine Translocation (TAT) secretion system . The bacterium notably lacks a beta-oxidation complex and typical Desulfovibrio cytochromes such as c553, c3, and ncc .

The organism's genome encodes more than 30 two-component regulatory systems, including a noteworthy new Ntr subcluster of hybrid kinases. Most histidine kinases (HKs) from D. psychrophila fall into six phylogenetic groups, with the majority clustering in the Ntr group, forming a distinct subcluster unique to Desulfotalea that doesn't include members from other bacterial genera .

Functional Role in Bacterial Lipoprotein Processing

Prolipoprotein diacylglyceryl transferase (Lgt) plays a critical role in bacterial lipoprotein biosynthesis as the first enzyme in a sequential three-enzyme pathway for lipoprotein modification . The enzyme specifically catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in the lipobox motif of prolipoproteins . This reaction results in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product .

Bacterial lipoproteins typically contain a conserved N-terminal signal sequence with a characteristic lipobox motif [L−4-A(S)−3-G(A)−2-C+1], where the invariant cysteine at position +1 becomes the first amino acid of the mature protein after modification . The complete lipoprotein maturation pathway involves:

  1. Lgt-catalyzed diacylglyceryl transfer to the cysteine thiol

  2. Signal peptidase II (Lsp) cleavage of the signal peptide

  3. Apolipoprotein N-acyltransferase (Lnt) addition of a third acyl chain

Membrane Topology and Localization

Studies on Lgt from other bacterial species, particularly Escherichia coli, have established that Lgt is an integral inner membrane protein . Its membrane topology has been determined through fusion to reporter enzymes such as β-galactosidase and alkaline phosphatase, as well as by substituted cysteine accessibility methods . This localization is consistent with its function in processing prolipoproteins as they emerge from the Sec or Tat secretion machinery on the outer leaflet of the cytoplasmic membrane .

Functional Conservation Across Bacterial Species

The Lgt enzyme's function is highly conserved across diverse bacterial species, reflecting its essential role in bacterial physiology. Studies in other bacterial systems, particularly in E. coli, have demonstrated that Lgt is essential for growth, as evidenced by analysis of lgt depletion strains . This conservation suggests that the D. psychrophila Lgt likely performs similar catalytic functions despite adaptations to cold environments.

Role in Bacterial Pathogenicity and Immune Response

Although not directly studied in D. psychrophila, research on Lgt in Staphylococcus aureus has demonstrated its importance in pathogenicity and immune response modulation. Δlgt mutants of S. aureus show markedly decreased induction of proinflammatory cytokines in various human cell types and reduced pathogenicity in mouse models . These mutants are severely affected in iron acquisition under infectious conditions and show decreased induction of cytokines via the TLR2-MyD88 signaling pathway .

The comparison between D. psychrophila Lgt and its counterparts in pathogenic bacteria offers insights into the evolution of this enzyme across different ecological niches, from cold marine environments to mammalian hosts.

Research Applications

Recombinant D. psychrophila Lgt serves as a valuable research tool for studying:

  1. Cold adaptation mechanisms in enzymes from psychrophilic organisms

  2. Bacterial lipoprotein biosynthesis pathways

  3. Structural biology of membrane-associated enzymes

  4. Comparative biochemistry across different bacterial taxa

Biotechnological Potential

As an enzyme from a psychrophilic organism, D. psychrophila Lgt may possess unique properties that could be exploited in biotechnological applications:

  1. Cold-active enzymatic processes in industrial settings

  2. Template for protein engineering to enhance cold activity in other enzymes

  3. Development of expression systems optimized for cold environments

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; DP0851; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Target Names
lgt
Target Protein Sequence
MSYYTLPPIDPIIMSLGPISIRWYGLMYVIGFFATYFLVRQQIQRHQFTQLEKNFDNLNT VLILCVILGGRLGYVVFYNLSYYLQHPLEILATWHGGMSFHGACIALILGGLIFCKIKKI DFWATADVYVATIPIGLGLGRIGNLINGELYGRVTEQPWGIIFPNGGPLPRHASQLYESL LEGLILFIILWSLRNRPWKRNSLTPHGTILSLFLCLYGLFRIIIENFRQPDPQLGFIVAH ITMGQLLSGAMILCGLTLWFWRIHQKKRATAL
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: dps:DP0851

STRING: 177439.DP0851

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme that catalyzes the first step in bacterial lipoprotein modification. It transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine in prolipoproteins, resulting in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This modification is crucial for proper lipoprotein processing and function in bacterial cells. In Desulfotalea psychrophila specifically, lgt (gene locus DP0851) plays a critical role in the modification of lipoproteins that contribute to the organism's unique cold-adapted physiological properties .

How does D. psychrophila adapt to cold environments, and what role might lgt play?

Desulfotalea psychrophila is a marine sulfate-reducing delta-proteobacterium capable of growth at temperatures below 0°C, making it a model organism for studying cold adaptation mechanisms . Genomic analysis reveals that D. psychrophila possesses nine putative cold shock proteins and nine potentially cold shock-inducible proteins that likely contribute to its psychrophilic nature . As lgt is responsible for the first step in lipoprotein modification, it may play a critical role in maintaining membrane fluidity and protein functionality at low temperatures. The proper functioning of lgt ensures that membrane-associated lipoproteins are correctly modified, which is particularly important in cold environments where membrane rigidity can be problematic for cellular processes .

What are the optimal conditions for expressing recombinant D. psychrophila lgt?

For optimal expression of recombinant D. psychrophila lgt, consider the following methodological approach:

  • Expression System: Use E. coli expression systems with cold-inducible promoters to mimic the native low-temperature environment of D. psychrophila.

  • Temperature: Initial growth at 37°C until reaching logarithmic phase, followed by temperature reduction to 10-15°C before induction to enhance proper folding of this cold-adapted protein.

  • Induction: Low concentrations of inducer (e.g., 0.1-0.5 mM IPTG) for longer periods (12-24 hours) to slow protein expression and improve folding.

  • Media Supplementation: Addition of glycerol (5%) and reduced salt concentration to simulate marine conditions while maintaining osmotic balance.

  • Purification Strategy: Given lgt is a membrane protein, solubilization using mild detergents such as n-octyl-β-D-glucoside, which has been successful for E. coli lgt .

This approach is based on experimental methods used for other membrane proteins from psychrophilic organisms and the specific properties of lgt as documented in the literature .

How can researchers assay the enzymatic activity of D. psychrophila lgt?

To assay D. psychrophila lgt enzymatic activity, researchers can employ a methodology similar to that used for other bacterial lgt proteins, with adaptations for cold-temperature activity:

  • Substrate Preparation: Purify or synthesize appropriate substrate analogs mimicking the natural prolipoprotein signal sequences containing the conserved lipobox motif [L-A(S)-G(A)-C] .

  • Membrane Fraction Preparation:

    • Isolate membrane fractions containing recombinant lgt using ultracentrifugation

    • Solubilize membranes using n-octyl-β-D-glucoside at concentrations of 1-2%

    • Maintain low temperatures (0-4°C) throughout the procedure to preserve enzymatic activity

  • Enzymatic Assay Setup:

    • Reaction buffer: Tris-HCl pH 7.5-8.0 (temperature-adjusted pH)

    • Include divalent cations (Mg²⁺) and reducing agents (DTT)

    • Add phosphatidylglycerol as the diacylglyceryl donor

    • Temperature range: Test at 0-15°C to determine optimal activity temperature

  • Detection Methods:

    • Radiolabeled assays using ³²P-labeled phosphatidylglycerol

    • Mass spectrometry to detect modified peptide products

    • Western blotting using antibodies against the diacylglyceryl moiety

  • Data Analysis:

    • Calculate enzyme kinetics parameters (Km, Vmax) at various temperatures

    • Compare with mesophilic lgt enzymes to identify cold-adaptation features

This approach incorporates methodologies adapted from studies of E. coli lgt while accounting for the psychrophilic nature of D. psychrophila .

What are the recommended storage conditions for recombinant D. psychrophila lgt protein?

Based on available data for recombinant D. psychrophila lgt, the following storage conditions are recommended:

  • Primary Storage: Store at -20°C for regular use or -80°C for long-term storage to maintain protein stability and prevent degradation .

  • Storage Buffer Composition:

    • Tris-based buffer (typically 20-50 mM, pH 7.5-8.0)

    • 50% glycerol as a cryoprotectant to prevent freezing damage

    • Buffer should be optimized specifically for this protein's stability requirements

  • Working Aliquots:

    • Prepare small aliquots for single-use applications to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week to maintain activity

  • Handling Precautions:

    • Repeated freezing and thawing is not recommended as it can significantly reduce enzymatic activity

    • Maintain a cold chain during all handling procedures

    • Consider adding protease inhibitors to prevent degradation during storage

These recommendations align with established protocols for membrane-associated enzymes from psychrophilic organisms and specific guidelines for the D. psychrophila lgt protein preparation .

How does the structure and function of D. psychrophila lgt compare to its homologs in mesophilic and thermophilic bacteria?

Comparative analysis of D. psychrophila lgt with its mesophilic and thermophilic homologs reveals several key differences:

FeatureD. psychrophila lgt (Psychrophilic)E. coli lgt (Mesophilic)Thermophilic Homologs
Amino Acid CompositionHigher proportion of glycine, decreased proline contentModerate glycine and proline contentIncreased proline and charged residues
Structural FlexibilityEnhanced flexibility through reduced hydrophobic interactionsModerate flexibility balanced with stabilityRigid structure with numerous stabilizing interactions
Catalytic EfficiencyHigher kcat at low temperatures (0-15°C)Optimal activity at moderate temperatures (25-37°C)Requires high temperatures for activation
Thermal StabilityLow thermal stability, rapidly inactivated above 25°CModerate thermal stabilityHigh thermal stability, active at >60°C
Conserved MotifsContains the Lgt signature motif with cold-adapted variationsStandard Lgt signature motifThermostable variations of the Lgt signature motif

The D. psychrophila lgt likely possesses molecular adaptations that enable it to maintain catalytic efficiency at low temperatures, including reduced structural rigidity and modified substrate binding interactions. These adaptations would distinguish it from the E. coli enzyme, which requires seven transmembrane segments and contains highly conserved residues such as Y26, N146, and G154 that are essential for function . Understanding these differences provides insight into the molecular mechanisms of cold adaptation in membrane-bound enzymes.

What is the role of D. psychrophila lgt in bacterial cold adaptation mechanisms?

D. psychrophila lgt likely plays a crucial role in cold adaptation through several mechanisms:

  • Membrane Fluidity Regulation: By facilitating the proper modification of lipoproteins, lgt contributes to maintaining appropriate membrane fluidity at low temperatures. The diacylglyceryl modification of lipoproteins affects their membrane anchoring properties, which is critical in cold environments where membrane rigidity increases .

  • Cold-Responsive Protein Modification: D. psychrophila contains nine putative cold shock proteins and nine potentially cold shock-inducible proteins . Proper modification of these proteins by lgt may be essential for their function during cold stress.

  • Metabolic Pathway Support: D. psychrophila possesses unusual metabolic features for a sulfate-reducing bacterium, including TRAP-T systems for C4-dicarboxylate uptake and a complete TCA cycle . Lipoproteins modified by lgt likely participate in these metabolic pathways, supporting energy production at low temperatures.

  • Regulatory System Integration: With more than 30 two-component regulatory systems, including a new Ntr subcluster of hybrid kinases , D. psychrophila has sophisticated environmental sensing mechanisms. Properly modified lipoproteins may serve as receptors or signal transducers in these regulatory networks, enabling rapid response to environmental changes.

The specialized function of lgt in this psychrophilic organism represents an adaptation that allows cellular processes to continue efficiently despite the kinetic constraints imposed by low temperatures.

What methodological approaches can be used to study the structure-function relationship of D. psychrophila lgt?

To elucidate the structure-function relationship of D. psychrophila lgt, researchers can employ the following comprehensive methodological approaches:

  • Structural Analysis Techniques:

    • X-ray crystallography of purified protein (challenging for membrane proteins)

    • Cryo-electron microscopy to visualize membrane-embedded configurations

    • NMR spectroscopy for dynamic structural elements

    • Molecular modeling using homology to E. coli lgt as a template, with validation through experimental data

  • Site-Directed Mutagenesis Studies:

    • Target conserved residues identified in alignment studies, particularly those in the Lgt signature motif

    • Create alanine substitutions of highly conserved residues (similar to E. coli studies where Y26, N146, and G154 were found to be essential)

    • Develop complementation assays using an lgt depletion strain similar to the E. coli PAP9403 system

  • Functional Analysis Methods:

    • Enzyme kinetics at various temperatures (0-25°C) to identify cold-adapted features

    • Thermal stability assays to determine melting temperature and inactivation profiles

    • Substrate specificity studies using various phospholipid donors and prolipoprotein acceptors

    • In vivo complementation studies in both psychrophilic and mesophilic hosts

  • Advanced Biophysical Techniques:

    • Hydrogen-deuterium exchange mass spectrometry to map flexible regions

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis

    • Membrane topology mapping using SCAM (substituted cysteine accessibility method)

    • Atomic force microscopy for visualization in near-native membrane environments

  • Computational Approaches:

    • Molecular dynamics simulations at various temperatures to study cold-adaptation mechanisms

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to investigate the catalytic mechanism

    • Sequence-based evolutionary analysis to identify cold-adapted signatures

These methodologies, adapted from studies on E. coli lgt and other membrane proteins, provide a comprehensive framework for understanding how D. psychrophila lgt has evolved to function efficiently in cold environments.

How does D. psychrophila lgt integrate with other lipoprotein processing enzymes in the cell membrane?

In D. psychrophila, lgt functions as part of a coordinated lipoprotein processing pathway within the cell membrane. Based on comparative analysis with other bacterial systems, this pathway likely involves:

  • Sequential Processing System:

    • Lgt (Prolipoprotein diacylglyceryl transferase) catalyzes the initial attachment of a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine in prolipoproteins

    • Lsp (Signal peptidase II) subsequently cleaves the signal peptide at the amino-terminal end of the diacylated cysteine

    • Lnt (Apolipoprotein N-acyltransferase) adds a third acyl chain to the α-amino group of the N-terminal cysteine in proteobacteria

  • Spatial Organization:

    • All three enzymes are likely embedded in the inner membrane with specific spatial relationships

    • Lgt appears to be organized with seven transmembrane segments, with its N-terminus facing the periplasm and C-terminus facing the cytoplasm (based on E. coli lgt topology)

    • This specific membrane topology facilitates access to both the lipid substrate in the membrane and the prolipoprotein substrate emerging from the Sec or Tat secretion machinery

  • Regulatory Coordination:

    • The three enzymes must work in a coordinated fashion for efficient lipoprotein processing

    • In D. psychrophila, this coordination may involve cold-adapted regulatory mechanisms given the organism's psychrophilic nature

    • Two-component regulatory systems (with D. psychrophila encoding more than 30 such systems) may play a role in modulating the expression and activity of these enzymes in response to environmental conditions

  • Metabolic Integration:

    • The lgt reaction requires phosphatidylglycerol as a substrate, linking lipoprotein processing to phospholipid metabolism

    • Given D. psychrophila's unique metabolic features, including TRAP-T systems and a complete TCA cycle , the integration of lipid metabolism and lipoprotein processing may involve cold-adapted regulatory mechanisms

What genomic context surrounds the lgt gene in D. psychrophila and what does this suggest about its regulation?

The genomic context of lgt (DP0851) in D. psychrophila provides significant insights into its regulation and functional relationships:

  • Genomic Organization:

    • The D. psychrophila genome consists of a 3,523,383 bp circular chromosome with 3,118 predicted genes and two plasmids of 121,586 bp and 14,663 bp

    • The lgt gene is located within the main chromosome as part of the core genome rather than on either plasmid

    • Its specific genomic neighborhood likely includes genes involved in membrane biosynthesis and/or protein secretion pathways, based on functional association patterns observed in other bacteria

  • Regulatory Elements:

    • Analysis of the D. psychrophila genome revealed more than 30 two-component regulatory systems, including a new Ntr subcluster of hybrid kinases

    • The promoter region of lgt may contain binding sites for cold-responsive transcription factors, given that D. psychrophila encodes nine putative cold shock proteins and nine potentially cold shock-inducible proteins

    • The regulation of lgt expression likely interfaces with the organism's sophisticated environmental sensing mechanisms to adapt to temperature fluctuations

  • Comparative Genomics Insights:

    • Comparison with the genome of Archaeoglobus fulgidus (a hyperthermophilic archaeon and sulfate reducer) revealed "many striking differences, but only a few shared features"

    • These differences likely extend to the genomic context and regulation of lgt, reflecting adaptations to vastly different thermal environments

    • The genomic context of lgt in D. psychrophila likely contains cold-adaptation-specific elements not found in mesophilic or thermophilic counterparts

  • Functional Implications:

    • The genomic neighborhood of lgt may include genes involved in the TRAP-T systems identified as major routes for the uptake of C4-dicarboxylates in D. psychrophila

    • The TAT secretion system genes identified in the D. psychrophila genome may be functionally associated with lgt, as they represent an alternative pathway for lipoprotein secretion

These genomic context observations suggest that lgt regulation in D. psychrophila is likely integrated with cold-responsive regulatory networks and specialized metabolic pathways that contribute to the organism's psychrophilic lifestyle.

How can D. psychrophila lgt be utilized in low-temperature biotechnology applications?

The unique cold-adapted properties of D. psychrophila lgt present several promising biotechnology applications:

  • Cold-Active Enzyme Biocatalysis:

    • Development of cold-active enzymatic systems for industrial processes that benefit from low-temperature conditions

    • Applications in food processing, where low temperatures preserve flavor, nutritional value, and texture

    • Use in pharmaceutical manufacturing processes that require low temperatures to preserve unstable compounds

    • Integration into bioremediation strategies for cold environments like polar regions or deep-sea locations

  • Membrane Protein Engineering:

    • Utilization of D. psychrophila lgt as a model for engineering cold-active membrane proteins

    • Development of chimeric enzymes incorporating cold-adapted domains from D. psychrophila lgt into mesophilic homologs

    • Creation of expression systems optimized for cold-temperature production of membrane proteins

  • Lipoprotein Display Technology:

    • Engineering of low-temperature lipoprotein display systems using D. psychrophila lgt for surface display of functional proteins

    • Development of cold-active biosensors utilizing lipoprotein anchoring for environmental monitoring in cold regions

    • Creation of vaccine delivery systems that maintain stability in cold-chain environments

  • Structural Biology Insights:

    • Using D. psychrophila lgt as a model system to understand general principles of protein cold adaptation

    • Application of these principles to engineer other enzymes for improved low-temperature activity

    • Development of predictive models for protein behavior at low temperatures based on lgt structure-function relationships

These applications leverage the natural cold adaptation of D. psychrophila lgt to address technological challenges in various biotechnology sectors requiring low-temperature operations.

What are the most significant knowledge gaps in understanding D. psychrophila lgt function?

Despite advances in understanding bacterial lgt enzymes, several critical knowledge gaps remain regarding D. psychrophila lgt:

  • Structural Determinants of Cold Adaptation:

    • The precise structural features that enable D. psychrophila lgt to function effectively at low temperatures remain uncharacterized

    • How local flexibility and global stability are balanced in this cold-adapted enzyme is not fully understood

    • The specific amino acid substitutions that confer cold activity compared to mesophilic homologs require detailed characterization

  • Catalytic Mechanism Variations:

    • Whether D. psychrophila lgt employs the same catalytic mechanism as mesophilic homologs or has evolved alternative reaction pathways

    • How substrate binding is affected by low temperatures and what compensatory mechanisms may exist

    • The temperature-dependent kinetic parameters and their molecular basis

  • Regulatory Networks:

    • How lgt expression is regulated in response to temperature changes in D. psychrophila

    • The role of the numerous two-component regulatory systems in modulating lgt activity

    • Whether lgt is subject to post-translational modifications specific to cold adaptation

  • Substrate Specificity:

    • Whether D. psychrophila lgt has evolved different substrate preferences compared to mesophilic homologs

    • How the composition of phospholipids in psychrophilic membranes affects lgt activity

    • The recognition elements in prolipoproteins that may differ in cold-adapted organisms

  • Physiological Role in Cold Environments:

    • The complete spectrum of lipoproteins modified by lgt in D. psychrophila and their functions

    • How lipoprotein modification contributes to D. psychrophila's role in global carbon and sulfur cycles in cold marine sediments

    • The potential role of lgt in biofilm formation and community interactions in cold environments

Addressing these knowledge gaps would significantly advance our understanding of bacterial adaptation to extreme environments and provide new insights into the evolution of enzymatic functions across temperature gradients.

What novel experimental approaches could advance D. psychrophila lgt research?

Several innovative experimental approaches could significantly advance research on D. psychrophila lgt:

  • Advanced Structural Biology Techniques:

    • Implementation of microcrystal electron diffraction (MicroED) for structural determination of membrane proteins without the need for large crystals

    • Application of cryo-electron tomography to visualize lgt in its native membrane environment

    • Development of nanodiscs specifically designed for cold-active membrane proteins to maintain native-like lipid environments during structural studies

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and lipidomics to understand how lgt function integrates with global cellular responses to cold

    • Development of D. psychrophila-specific genetic tools for genome editing using CRISPR-Cas systems adapted for low-temperature function

    • Construction of synthetic minimal lipoprotein processing pathways to study interactions between lgt and other components

  • Single-Molecule Biophysics:

    • Application of single-molecule FRET to monitor conformational dynamics of lgt at low temperatures

    • Development of high-resolution atomic force microscopy techniques to visualize lgt activity in membrane patches

    • Use of optical tweezers to measure force generation during lgt-catalyzed reactions at various temperatures

  • Computational Approaches:

    • Integration of machine learning with molecular dynamics to predict cold-adaptation mechanisms

    • Development of specialized force fields for simulating protein dynamics at low temperatures

    • Quantum mechanical simulations of the catalytic mechanism at different temperatures

  • Experimental Evolution:

    • Directed evolution of D. psychrophila lgt under various temperature regimes to identify key adaptive mutations

    • Laboratory evolution of mesophilic lgt homologs toward cold adaptation to recapitulate natural evolutionary trajectories

    • Ancestral sequence reconstruction to trace the evolutionary history of cold adaptation in lgt enzymes

  • Translational Research:

    • Development of cold-active cell-free protein synthesis systems incorporating D. psychrophila lgt

    • Engineering of hybrid enzymes combining domains from psychrophilic and mesophilic lgt variants

    • Creation of temperature-responsive biosensors based on conformational changes in D. psychrophila lgt

These novel approaches would provide unprecedented insights into the structure, function, and evolution of D. psychrophila lgt while advancing broader understanding of enzyme adaptation to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.