Recombinant Desulfotalea psychrophila Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include this information in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
htpX; DP1671; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Target Names
htpX
Target Protein Sequence
MFRVGLFLATNLAILLLLGLVMSLLGLDSRSASGLLLMAGCFGMGGSLISLALSKWIAKK ATGAHVIEQPRNGTEEWLLHTVARQAQTAGIGMPEVAVYEADDMNAFATGMRRDAALVAV STGLIRGMSQDEVEAVLAHEMSHIANGDMVTLSLIQGVLNTFVIFLSRMAANVIDNFLSS DEDGGGLGFFGYMAVSMLLEFVFGLFASMIVMWFSRRREFRADYGATELASKQKMIAALA RLQQQHISSSLPEQVAAFGIRPRQGGLAELFRSHPSLEDRIAALEAI
Uniprot No.

Target Background

Database Links

KEGG: dps:DP1671

STRING: 177439.DP1671

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its primary function?

HtpX is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. The primary function of HtpX involves the quality control of membrane proteins, where it eliminates malfolded or misassembled membrane proteins that could potentially disturb the structure and function of biological membranes. This quality control mechanism is crucial for maintaining normal cellular activities . In Desulfotalea psychrophila, HtpX likely plays a similar role, but may have specific adaptations related to functioning at low temperatures given the psychrophilic nature of this organism .

How is the D. psychrophila HtpX gene organized in its genome?

The htpX gene is part of the 3,523,383 bp circular chromosome of Desulfotalea psychrophila strain LSv54. The genome contains 3,118 predicted genes in total, and the htpX gene is designated by the ordered locus name DP1671. This gene is one of many that contribute to D. psychrophila's ability to function as a sulfate-reducing delta-proteobacterium in permanently cold marine sediments . The genomic context of htpX may provide insights into its regulation and functional interactions within the cell's protein quality control network.

How does D. psychrophila HtpX compare with HtpX homologs from other bacteria?

D. psychrophila HtpX shares fundamental structural features with other bacterial HtpX homologs, such as the conserved zinc-binding motif characteristic of M48 family metalloproteinases. When compared to E. coli HtpX, which has been more extensively studied, both proteins are integral membrane proteins with multiple transmembrane segments .

What expression systems are optimal for producing recombinant D. psychrophila HtpX?

E. coli expression systems are commonly used for producing recombinant HtpX proteins, including those from D. psychrophila. For optimal expression of psychrophilic proteins, lower induction temperatures (15-20°C) may increase the yield of properly folded protein. Expression constructs typically include affinity tags such as His-tags to facilitate purification .

When expressing D. psychrophila HtpX, researchers should consider:

  • Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Employing temperature-regulated expression systems to mimic the cold environment of D. psychrophila

  • Including appropriate detergents during extraction and purification

  • Optimizing buffer conditions to maintain protein stability and activity

How can researchers establish an in vivo protease activity assay for D. psychrophila HtpX?

Based on methodologies developed for E. coli HtpX, an in vivo protease activity assay for D. psychrophila HtpX can be established using model substrates. The key steps include:

  • Design and construction of a model substrate containing D. psychrophila HtpX cleavage sites

  • Creation of expression constructs for both the substrate and HtpX

  • Co-expression of the substrate and HtpX in appropriate host cells

  • Detection of substrate cleavage using methods such as Western blotting or fluorescence-based assays

This approach enables semiquantitative and convenient detection of protease activity, allowing researchers to assess the effects of mutations in conserved regions of HtpX or environmental conditions on its activity .

What purification strategy is recommended for recombinant D. psychrophila HtpX?

For purification of recombinant D. psychrophila HtpX, the following strategy is recommended:

  • Expression with an N-terminal or C-terminal His-tag in an appropriate E. coli strain

  • Cell lysis using methods that effectively solubilize membrane proteins (e.g., detergent-based extraction)

  • Initial purification using immobilized metal affinity chromatography (IMAC)

  • Further purification using size exclusion chromatography to separate aggregates

  • Storage in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for long-term storage

The purification process should be conducted at lower temperatures (4°C) to maintain the stability of this psychrophilic protein. After purification, the protein should be aliquoted to avoid repeated freeze-thaw cycles that could compromise its activity .

How does temperature affect the activity and stability of D. psychrophila HtpX?

As a protein from a psychrophilic organism capable of growth at temperatures below 0°C, D. psychrophila HtpX likely exhibits optimal activity at lower temperatures compared to mesophilic homologs. Psychrophilic enzymes typically display higher catalytic efficiency at low temperatures, which is usually accompanied by decreased thermal stability .

Researchers can characterize the temperature-activity profile by:

  • Measuring proteolytic activity across a temperature range (0-37°C)

  • Determining thermal stability through differential scanning calorimetry or thermal shift assays

  • Comparing kinetic parameters (kcat, KM) at different temperatures

  • Analyzing structural flexibility through hydrogen-deuterium exchange or limited proteolysis

Understanding these temperature-dependent properties is crucial for optimizing experimental conditions and gaining insights into cold adaptation mechanisms.

How does D. psychrophila HtpX contribute to cold adaptation mechanisms?

D. psychrophila, as a psychrophilic bacterium capable of growth at temperatures below 0°C, requires specialized mechanisms for protein quality control at low temperatures. HtpX likely plays a crucial role in this process by:

  • Recognizing and degrading proteins that misfold specifically under cold conditions

  • Having structural adaptations that maintain catalytic efficiency at low temperatures

  • Potentially interacting with other cold-adapted quality control systems

D. psychrophila encodes nine putative cold shock proteins and nine potentially cold shock-inducible proteins, suggesting a complex network of cold adaptation mechanisms that may involve HtpX . The study of HtpX in this context provides valuable insights into bacterial adaptation to extreme environments.

What structural features of D. psychrophila HtpX enable its function at low temperatures?

The structural adaptations of D. psychrophila HtpX that enable function at low temperatures likely include:

  • Increased flexibility of catalytic domains through reduced hydrophobic interactions

  • Decreased number of salt bridges and hydrogen bonds

  • Potential modifications in loop regions to maintain flexibility at low temperatures

  • Optimized surface charge distribution to interact with water molecules at low temperatures

Advanced structural studies using X-ray crystallography, cryo-electron microscopy, or computational modeling can help elucidate these features. Comparative analysis with mesophilic and thermophilic homologs would provide particular insights into temperature adaptation mechanisms.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of D. psychrophila HtpX?

Site-directed mutagenesis is a powerful approach for investigating the catalytic mechanism of D. psychrophila HtpX. Key targets for mutagenesis include:

  • The zinc-binding motif (HEXXH), which is characteristic of M48 metalloproteinases

  • Residues involved in substrate binding and recognition

  • Regions potentially involved in cold adaptation

The effect of mutations can be assessed using:

  • The in vivo protease activity assay with model substrates

  • In vitro enzymatic assays with purified protein

  • Thermal stability measurements

  • Structural analysis of mutant proteins

This approach can help identify residues critical for catalysis, substrate specificity, and cold adaptation .

What is the regulatory network controlling D. psychrophila htpX expression?

The expression of htpX in D. psychrophila is likely regulated as part of stress response pathways, particularly those responding to protein folding stress at low temperatures. The D. psychrophila genome encodes more than 30 two-component regulatory systems, including a new Ntr subcluster of hybrid kinases, which may be involved in regulating htpX expression .

Research approaches to elucidate this regulatory network include:

  • Transcriptomic analysis under various stress conditions

  • Promoter mapping and identification of regulatory elements

  • Chromatin immunoprecipitation to identify transcription factors binding to the htpX promoter

  • Construction of reporter gene fusions to monitor htpX expression in vivo

Understanding this regulatory network would provide insights into how D. psychrophila coordinates its protein quality control systems in response to environmental changes.

How does D. psychrophila HtpX compare to the E. coli homolog in terms of structure and function?

A comparative analysis between D. psychrophila and E. coli HtpX reveals both similarities and differences:

FeatureD. psychrophila HtpXE. coli HtpX
Length287 amino acidsApproximately 290 amino acids
Membrane topologyContains multiple hydrophobic regionsFour hydrophobic regions (H1-H4)
Catalytic motifContains HEXXH zinc-binding motifContains HEXXH zinc-binding motif
Temperature optimumLikely 0-15°C30-37°C
Genomic contextPart of cold adaptation mechanismsPart of heat shock response

Both proteins function in membrane protein quality control, but D. psychrophila HtpX has likely evolved specific adaptations for functioning at low temperatures, while E. coli HtpX operates optimally at mesophilic temperatures .

What insights can comparative genomics provide about the evolution of HtpX in psychrophilic bacteria?

Comparative genomic analysis of htpX genes across bacterial species, with particular focus on psychrophilic, mesophilic, and thermophilic organisms, can reveal:

  • Evolutionary conservation of catalytic domains versus adaptive changes in non-catalytic regions

  • Correlation between amino acid composition and optimal growth temperature

  • Co-evolution with other components of protein quality control systems

  • Potential horizontal gene transfer events

D. psychrophila's genome shows adaptations for life in permanently cold marine environments, and comparative analysis with other sulfate-reducing bacteria from different temperature niches would highlight specific adaptations of htpX for cold environments .

How do post-translational modifications affect D. psychrophila HtpX activity?

While specific data on post-translational modifications of D. psychrophila HtpX is limited, research on related proteases suggests several potential modifications that could regulate its activity:

  • Zinc binding is essential for catalytic activity

  • Potential phosphorylation sites may regulate activity or interactions

  • Redox modifications of cysteine residues might affect activity under oxidative stress

  • Potential proteolytic processing for activation or regulation

Research approaches to investigate these modifications include:

  • Mass spectrometry-based proteomic analysis

  • Site-directed mutagenesis of potential modification sites

  • Activity assays under various redox conditions

  • In vitro modification of purified protein followed by activity measurements

Understanding these modifications would provide insights into the regulation of HtpX activity in response to environmental changes.

How can understanding D. psychrophila HtpX contribute to biotechnological applications?

Research on D. psychrophila HtpX has several potential biotechnological applications:

  • Development of cold-active proteases for industrial processes that require low-temperature catalysis

  • Engineering proteases with modified specificity or temperature profiles

  • Creation of biosensors for monitoring protein folding stress in cold environments

  • Design of antimicrobial compounds targeting HtpX in pathogenic bacteria

The unique adaptations of this psychrophilic protease make it a valuable model for understanding protein function at low temperatures, with potential applications in various industrial and biomedical fields.

What are the most promising approaches for identifying physiological substrates of D. psychrophila HtpX?

Identifying the physiological substrates of D. psychrophila HtpX remains a significant challenge. Promising approaches include:

  • Proteomic comparison of wild-type and htpX-knockout D. psychrophila strains

  • Proximity labeling techniques to identify proteins interacting with HtpX

  • In vitro degradation assays using membrane protein extracts

  • Bioinformatic prediction of potential substrates based on known cleavage sites

Additionally, researchers can develop model substrates similar to those used for E. coli HtpX to facilitate the detection of proteolytic activity in vivo . These approaches, used in combination, would provide a comprehensive view of HtpX's role in protein quality control.

What experimental systems can be developed to study the role of D. psychrophila HtpX in cold adaptation?

To investigate the role of D. psychrophila HtpX in cold adaptation, researchers can develop:

  • Genetic systems for creating and complementing htpX mutations in D. psychrophila

  • Heterologous expression systems to compare D. psychrophila HtpX with homologs from mesophilic bacteria

  • Model substrates specifically designed to monitor proteolytic activity at low temperatures

  • In vitro reconstitution of membrane protein quality control systems

These experimental systems would enable detailed investigation of how HtpX contributes to protein homeostasis at low temperatures and provide insights into bacterial adaptation to cold environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.