Recombinant Desulfotomaculum reducens Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: Our standard shipping includes blue ice packs. If dry ice is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Dred_2703; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Desulfotomaculum reducens (strain MI-1)
Target Names
cobS
Target Protein Sequence
MFSSLRLAISFLTIFPFYNKMADNKELAQSVSYYPLVGFLLGSIAAGVCYAMHSIGLNLA ADVLGLVTIITLTGGLHQDGLMDTADGIFSGRELHRKLEIMKDSRVGAMGVIALATVLLL KIAFLFELDLAQKLTAFIMAPMAGRWAMVLAITRYPYARATGGLGACLKQAGKTQLALAT LILVAGCLWLFGLPGLALLGIVFFITWLTVEFIVKRLGGMTGDTYGALGEMIETWVIFLI LLGQQIRML
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Desulfotomaculum reducens and what makes it significant for cobalamin research?

Desulfotomaculum reducens strain MI-1 is a Gram-positive, sulfate-reducing bacterium with the additional capability of reducing Fe(III) . Its significance in cobalamin research stems from its unique biochemical properties as an environmental Gram-positive bacterium that has received less attention compared to pathogenic species. D. reducens grows anaerobically in basal Widdel Low Phosphate medium amended with trace elements and vitamins at pH 7.1 ± 0.1 . The bacterium's ability to perform metal reduction makes it an interesting model organism for studying electron transfer mechanisms that may involve cobalamin-dependent processes.

Unlike many well-characterized bacteria, D. reducens requires direct surface contact for electron transfer to extracellular electron acceptors, suggesting a unique electron transport chain that conveys reducing power from the cytoplasm across the cell membrane and cell wall to terminal electron acceptors . This characteristic may influence the functional properties of its cobalamin biosynthesis enzymes, including CobS.

What is the function of Cobalamin synthase (CobS) in bacterial metabolism?

Cobalamin synthase (CobS) catalyzes a critical step in the adenosylcobalamin (vitamin B12) biosynthesis pathway, specifically in the nucleotide loop assembly. Based on research with Salmonella typhimurium CobS, this enzyme facilitates the attachment of the lower ligand base (typically 5,6-dimethylbenzimidazole) to adenosylcobinamide-GDP to form adenosylcobalamin-5′-phosphate . This reaction is part of the late steps in adenosylcobalamin biosynthesis.

The functional characterization of CobS has demonstrated that it acts as the cobalamin(-5′-phosphate) synthase, accepting adenosylcobinamide-GDP (the product of the CobU reaction) and α-ribazole-5′-phosphate (the product of the CobT reaction) as substrates . The resulting adenosylcobalamin-5′-phosphate is subsequently dephosphorylated by CobC to produce the final adenosylcobalamin product. This pathway is essential for the synthesis of vitamin B12, a critical cofactor for numerous enzymatic reactions in bacterial metabolism.

How does the cobalamin biosynthetic pathway differ in D. reducens compared to other bacterial species?

While the specific details of the cobalamin biosynthetic pathway in D. reducens have not been fully characterized in the provided search results, comparative analysis can be made with the well-studied pathway in Salmonella typhimurium. In S. typhimurium, the nucleotide loop assembly pathway involves four key enzymes: CobU, CobS, CobT, and CobC .

The pathway begins with adenosylcobinamide, which is converted to adenosylcobinamide-GDP by CobU. Separately, CobT catalyzes the synthesis of α-ribazole-5′-phosphate from 5,6-dimethylbenzimidazole and nicotinate mononucleotide. CobS then joins adenosylcobinamide-GDP and α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate, which is finally dephosphorylated by CobC to yield adenosylcobalamin .

Given D. reducens' unique metabolic capabilities and environmental adaptations as a metal-reducing bacterium, its cobalamin biosynthesis pathway may contain modifications optimized for its anaerobic lifestyle and electron transport requirements. The specific regulatory mechanisms and potential interactions with other metabolic pathways likely differ from those in S. typhimurium and other well-studied organisms.

What expression systems are most effective for producing recombinant D. reducens CobS?

Based on experiences with similar enzymes, the expression of recombinant D. reducens CobS would likely benefit from strategies developed for other challenging proteins. For cobalamin-dependent enzymes, several approaches have proven successful:

The use of specialized expression plasmids that co-express genes involved in iron-sulfur cluster biogenesis, such as the pDB1282 plasmid containing the isc operon from Azotobacter vinelandii, has significantly improved the solubility of many recombinant proteins . This strategy was effective for ThnK, a cobalamin-dependent radical SAM enzyme, and might be beneficial for D. reducens CobS expression.

Alternatively, the pBAD42-BtuCEDFB plasmid, which encodes a cobalamin-uptake system, has been developed to improve the solubility of several cobalamin-dependent enzymes . This plasmid allows protein expression in standard LB medium supplemented with cobalamin, rather than requiring specialized media.

For expression, ethanolamine-M9 medium can drive the uptake of cobalamin into E. coli, which may be advantageous if D. reducens CobS requires cobalamin for proper folding or stability . This approach has proven useful for the expression of TsrM, another cobalamin-dependent enzyme.

What purification challenges are specific to D. reducens CobS and how can they be addressed?

While specific challenges for D. reducens CobS purification are not directly addressed in the search results, insights can be drawn from related proteins. Cobalamin-dependent enzymes often present several purification challenges:

  • Oxygen sensitivity: As D. reducens is an anaerobic organism, its CobS is likely oxygen-sensitive. Purification should be conducted under strictly anaerobic conditions, using glove boxes or specialized equipment to maintain an oxygen-free environment.

  • Cofactor retention: Ensuring that the cobalamin cofactor remains bound during purification is crucial for maintaining enzyme activity. Supplementing purification buffers with cobalamin may help maintain the integrity of the enzyme.

  • Protein stability: Based on experiences with cobalamin-dependent radical SAM enzymes, which are often unstable, the addition of stabilizing agents like glycerol (10-20%) and reducing agents (DTT or β-mercaptoethanol) to purification buffers may improve protein stability.

  • Solubility issues: Many cobalamin-dependent enzymes have low solubility. The use of solubility-enhancing fusion tags (such as MBP or SUMO) may improve solubility during expression and purification.

A strategic purification protocol might include affinity chromatography using a fusion tag, followed by size exclusion chromatography to separate the active enzyme from aggregates or degradation products, all performed under anaerobic conditions with appropriate cofactor supplementation.

What in vitro assay systems can be used to measure D. reducens CobS activity?

Based on established protocols for S. typhimurium CobS, a comprehensive in vitro assay system for D. reducens CobS would likely include the following components:

The complete reaction mixture would contain adenosylcobinamide-GDP (AdoCbi-GDP), α-ribazole-5′-phosphate (α-ribazole-5′-P), an appropriate buffer (such as Ches buffer, pH 9), MgCl2, and the purified recombinant CobS enzyme . The reaction would be incubated at 37°C for a specified time period, typically 1-1.5 hours.

Product formation can be monitored through reverse-phase HPLC analysis, identifying adenosylcobalamin-5′-phosphate by its characteristic retention time and UV-visible spectrum . Confirmation of product identity can be achieved through mass spectrometry.

A functional assay can also include a biological activity test, where the reaction product is tested for its ability to support the growth of a cobalamin auxotroph, such as the S. typhimurium strain JE212 used in the characterization of S. typhimurium CobS .

For a complete reconstitution of the cobalamin biosynthesis pathway, the assay can be expanded to include all four enzymes (CobU, CobS, CobT, and CobC) and their respective substrates: adenosylcobinamide, 5,6-dimethylbenzimidazole, nicotinate mononucleotide, and GTP .

How does temperature and pH affect the activity of recombinant D. reducens CobS?

While specific data on the temperature and pH optima for D. reducens CobS is not provided in the search results, we can extrapolate from related enzymes and the natural growth conditions of D. reducens.

For S. typhimurium CobS, the in vitro activity assays were conducted at 37°C in Ches buffer at pH 9 . This alkaline pH might be optimal for the catalytic mechanism of CobS, potentially by facilitating nucleophilic attack during the reaction.

To determine the optimal conditions for D. reducens CobS activity, a systematic evaluation of enzyme activity across a range of temperatures (e.g., 25-50°C) and pH values (e.g., pH 6-10) would be necessary. The enzyme's stability under these varying conditions should also be assessed to distinguish between conditions that enhance activity versus those that promote rapid denaturation.

What are the kinetic parameters of D. reducens CobS and how do they compare to CobS from other organisms?

While specific kinetic parameters for D. reducens CobS are not provided in the search results, a methodological approach to determining these values would include:

  • Measuring initial reaction rates at varying substrate concentrations to determine Km values for both adenosylcobinamide-GDP and α-ribazole-5′-phosphate.

  • Calculating Vmax and kcat values to assess the catalytic efficiency of the enzyme.

  • Investigating potential substrate inhibition or allosteric regulation by testing reaction rates at high substrate concentrations.

For comparison with CobS from other organisms, key parameters would include substrate specificity, catalytic efficiency (kcat/Km), and the reaction mechanism. S. typhimurium CobS has been shown to catalyze the formation of adenosylcobalamin-5′-phosphate from adenosylcobinamide-GDP and α-ribazole-5′-phosphate , but detailed kinetic parameters are not provided in the search results.

Differences in kinetic parameters between D. reducens CobS and those from other organisms might reflect adaptations to different cellular environments or roles in metabolism. As a metal-reducing bacterium that requires direct contact with extracellular electron acceptors, D. reducens may have evolved distinct properties in its cobalamin biosynthesis enzymes to support its unique metabolic capabilities.

What structural features are essential for D. reducens CobS catalytic activity?

While specific structural information about D. reducens CobS is not provided in the search results, insights can be drawn from related enzymes. Key structural features likely important for CobS catalytic activity include:

To definitively identify these structural features, a combination of X-ray crystallography, site-directed mutagenesis, and functional assays would be necessary. By systematically mutating conserved residues and testing the activity of the mutant enzymes, the specific residues critical for catalysis could be identified.

How can site-directed mutagenesis be used to elucidate the catalytic mechanism of D. reducens CobS?

A comprehensive site-directed mutagenesis approach to studying D. reducens CobS would include:

This systematic approach would provide insights into which residues are essential for substrate binding, catalysis, and structural integrity. For example, mutations that increase Km without affecting kcat would suggest a role in substrate binding, while mutations that decrease kcat would suggest a role in the catalytic mechanism.

How does D. reducens CobS compare functionally to CobS homologs from other bacterial species?

A comparative analysis of D. reducens CobS with homologs from other bacterial species would focus on several key aspects:

Substrate specificity: While S. typhimurium CobS uses adenosylcobinamide-GDP and α-ribazole-5′-phosphate as substrates , D. reducens CobS might have evolved to accommodate variations in these substrates, potentially reflecting differences in the availability of precursors in its natural environment.

Catalytic efficiency: Differences in kinetic parameters could reflect adaptations to different cellular conditions, such as the anaerobic environment in which D. reducens lives, compared to the facultative anaerobe S. typhimurium.

Regulatory mechanisms: The regulation of CobS activity might differ between species, with potential differences in allosteric regulation, post-translational modifications, or protein-protein interactions.

Structural features: Despite a common catalytic function, there might be significant structural differences between CobS homologs, particularly in regions outside the active site, reflecting adaptations to different cellular contexts.

In the broader context of cobalamin biosynthesis, it's noteworthy that while the basic pathway is conserved across many bacteria, there are significant variations in how the pathway is regulated and in the specific properties of the enzymes involved. These variations often reflect the ecological niches occupied by different bacteria and their specific metabolic requirements.

What role does horizontal gene transfer play in the evolution of cobalamin biosynthesis genes in D. reducens?

While the search results do not directly address horizontal gene transfer (HGT) in the context of D. reducens cobalamin biosynthesis genes, this is an important question for understanding the evolution of these pathways.

Cobalamin biosynthesis genes are known to be subject to HGT across various bacterial lineages, potentially due to the selective advantage conferred by the ability to synthesize this essential cofactor. For D. reducens, as a member of the Firmicutes phylum, analysis of its cobalamin biosynthesis genes, including cobS, for signatures of HGT would involve:

  • Comparative genomic analysis to identify any incongruence between the phylogeny of cobS and other cobalamin biosynthesis genes and the species phylogeny.

  • Analysis of sequence characteristics often associated with HGT, such as unusual GC content or codon usage patterns compared to the rest of the genome.

  • Examination of the genomic context of cobS and other cobalamin biosynthesis genes for evidence of genomic islands, prophage regions, or other mobile genetic elements.

  • Functional comparison of D. reducens CobS with homologs from taxonomically distant bacteria that share similar ecological niches, looking for unexpected functional similarities that might suggest HGT.

Understanding the role of HGT in the evolution of D. reducens cobalamin biosynthesis would provide insights into the selective pressures that have shaped these pathways and the ecological factors that might have driven the acquisition or loss of these genes.

How can recombinant D. reducens CobS be used to synthesize novel cobamides with research applications?

Recombinant D. reducens CobS, like its S. typhimurium counterpart, has significant potential for the synthesis of novel cobamides with various research applications. The in vitro system developed for S. typhimurium "offers a unique opportunity for the rapid synthesis and isolation of cobamides with structurally different lower-ligand bases that can be used to investigate the contributions of the lower-ligand base to cobalamin-dependent reactions" .

By exploiting the substrate flexibility of CobS, researchers could:

  • Synthesize cobamides with non-natural lower ligands by replacing 5,6-dimethylbenzimidazole with alternative bases. These novel cobamides could have altered reactivity or binding properties with cobalamin-dependent enzymes.

  • Produce isotopically labeled cobamides for NMR studies or mechanistic investigations by incorporating labeled precursors into the in vitro synthesis reaction.

  • Generate modified cobamides to probe the structural requirements for cobalamin-dependent radical SAM enzymes, which "act as methylases on unactivated carbon or phosphorus centers in natural product biosyntheses" .

  • Create cobamide analogs with photochemical properties for optogenetic applications by incorporating light-sensitive lower ligands.

The potential for using recombinant CobS in the synthesis of novel cobamides is particularly promising given the growing interest in cobalamin-dependent enzymes in biotechnology and their roles in various metabolic pathways.

What are the current limitations in working with recombinant D. reducens CobS and how might they be overcome?

While specific limitations for D. reducens CobS are not directly addressed in the search results, general challenges with cobalamin-dependent enzymes suggest several potential limitations and solutions:

  • Oxygen sensitivity: As an enzyme from an anaerobic organism, D. reducens CobS is likely oxygen-sensitive. This limitation could be addressed through improved anaerobic handling techniques, the development of oxygen-tolerant variants through protein engineering, or the identification of stabilizing additives that protect the enzyme from oxidative damage.

  • Protein solubility and stability: Many cobalamin-dependent enzymes are difficult to express in soluble form. Advances in expression systems, such as the plasmid pBAD42-BtuCEDFB , which improves the solubility of several cobalamin-dependent enzymes, may help overcome this limitation.

  • Substrate availability: The natural substrates for CobS, adenosylcobinamide-GDP and α-ribazole-5′-phosphate, may be difficult to obtain in quantities needed for large-scale applications. Developing efficient synthetic routes to these compounds or identifying more readily available substrate analogs could address this limitation.

  • Incomplete understanding of structure-function relationships: Limited structural information about CobS from various species hampers rational engineering efforts. Advances in structural biology techniques, including cryo-electron microscopy and computational modeling, may provide deeper insights into the structural basis of CobS function.

  • Limited substrate scope: CobS may have restrictions on the range of non-natural substrates it can accept. Directed evolution approaches could be used to expand the substrate scope, potentially leading to enzymes capable of synthesizing a wider range of novel cobamides.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.