Recombinant Desulfotomaculum reducens Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Desulfotomaculum reducens Cobalt transport protein CbiM (cbiM) is a membrane-bound protein involved in cobalt uptake through energy-coupling factor (ECF) transporters. This protein enables cobalt acquisition for metabolic processes in D. reducens, a Gram-positive bacterium notable for sulfate and metal reduction . Produced via heterologous expression systems, recombinant CbiM serves as a critical tool for studying microbial metal homeostasis and ECF transporter mechanisms .

Recombinant Production

Recombinant CbiM is synthesized in E. coli with high purity (>90%) and specific tags for purification :

ParameterDetails
Host SystemEscherichia coli
Affinity TagN-terminal His-tag
Purity≥85% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water with 5–50% glycerol for stability

Functional Insights

CbiM operates within the CbiMNQO complex to mediate cobalt transport:

  • Mechanism: ATP hydrolysis by CbiO subunits induces conformational changes in CbiM, enabling cobalt translocation across the membrane .

  • Substrate Specificity: Binds free Co²⁺ ions but shows no activity with cobalt chelates (e.g., cobalamin) .

  • Energy Coupling: Requires interaction with CbiQ (transmembrane subunit) and CbiO (ATPase) for transport .

Functional assays:

  • ATPase activity of the CbiMQO complex is independent of cobalt concentration, suggesting constitutive energy coupling .

  • Deletion of SM0 disrupts transporter assembly but not substrate binding .

Research Applications

Recombinant CbiM is utilized in:

  • Metal Homeostasis Studies: Investigating cobalt uptake in anaerobic bacteria .

  • ECF Transporter Mechanistics: Structural analysis of substrate gating and ATPase coupling .

  • Biotechnological Engineering: Optimizing metal recovery systems via synthetic biology .

Proteomic and Genomic Context

  • Genomic Locus: cbiM (Dred_2731) is part of a cobalt utilization operon in D. reducens .

  • Proteomic Expression: Constitutively expressed under sulfate-reducing and metal-stressed conditions, highlighting its essential role .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the protein according to your specifications.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
cbiM; Dred_2731; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-250
Protein Length
Full Length of Mature Protein
Species
Desulfotomaculum reducens (strain MI-1)
Target Names
cbiM
Target Protein Sequence
MHIAEGFLPAGWCLFWLALSVPFVFWGIRSIHISLRGNPHLKMLLGLAGAFVFVLSALKI PSVTGSCSHPTGVGLGAILFGPAVMSVLGCIVLLFQALLLAHGGITTLGANVFSMGVMGP LVSYGVYQLLKKRNTKVAVFLAASLGNMTTYMVTSLQLAMAFPDKTGNLLVSFFKFMSIF AITQIPLAITEGLLTVFVFNLLNNYREELYPGLPKEERSGPYDFVN
Uniprot No.

Target Background

Function
This protein is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which is involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Desulfotomaculum reducens and what role does CbiM play in its metabolism?

Desulfotomaculum reducens strain MI-1 is a Gram-positive, sulfate-reducing bacterium capable of reducing Fe(III) and other metals. As an anaerobic organism, it has been studied extensively for its metal reduction capabilities . The CbiM protein functions as a key component of the CbiMNQO complex, a cobalt transport system essential for vitamin B12 (cobalamin) biosynthesis. In D. reducens, this protein is particularly important because cobalt is a critical micronutrient that supports the organism's growth and metabolic functions in anaerobic environments. The protein is embedded in the cytoplasmic membrane and works in concert with other components of the transport system to facilitate cobalt uptake into the cell.

How is the cbiM gene identified and characterized in D. reducens?

The cbiM gene in D. reducens can be identified through genomic analysis and comparative genomics approaches. Researchers typically:

  • Analyze the complete genome sequence of D. reducens MI-1

  • Use bioinformatics tools to identify open reading frames with sequence homology to known cobalt transporters

  • Examine the genomic context to identify gene clusters containing cbiM and other components of the CbiMNQO complex

  • Confirm gene identity through sequence alignment with characterized cbiM genes from related organisms

The cbiM gene in D. reducens is often found in an operon structure alongside other cobalt transport genes (cbiN, cbiQ, and cbiO), reflecting the functional relationship between these components in forming a complete transport system.

What growth conditions are required for studying CbiM expression in D. reducens?

Based on experimental protocols used for D. reducens, optimal growth conditions for studying CbiM expression include:

ParameterRecommended ConditionNotes
MediumWiddel Low Phosphate (WLP)Amended with trace elements and vitamins
pH7.1 ± 0.1Critical for optimal growth
Temperature37°CMaintained throughout growth period
AtmosphereAnaerobicSealed serum bottles with butyl rubber stoppers
Carbon SourceLactate or pyruvate (20 mM)Pyruvate for fermentative growth
Supplements0.05% yeast extract, 30 mM NaHCO₃Enhances growth
Metal availabilityVaried cobalt concentrationsTo study regulation of cobalt transport
Growth phaseLate exponential phaseOptimal for protein expression studies

For specific CbiM expression studies, researchers should consider modifying cobalt availability in the growth medium to observe regulatory effects on the expression of the cbiM gene.

What protein extraction methods are effective for isolating membrane-bound CbiM?

Effectively isolating membrane-bound proteins like CbiM from D. reducens requires specialized extraction protocols. Based on successful approaches with similar bacteria, the following methodology is recommended:

  • Cell harvest and washing: Centrifuge cultures at 8000 × g for 15 minutes and wash cell pellets with appropriate buffer

  • Cell disruption: Use one or more of the following methods:

    • Sonication in buffer containing protease inhibitors

    • French pressure cell

    • Gentle enzymatic treatment with lysozyme (similar to protocols used for surfaceome analysis)

  • Membrane fraction isolation: Ultracentrifugation at 100,000 × g for 1 hour to separate membrane fraction

  • Membrane protein solubilization: Use mild detergents such as:

    • n-Dodecyl β-D-maltoside (DDM)

    • Digitonin

    • CHAPS

  • Protein purification: Employ affinity chromatography if working with tagged recombinant proteins

The choice of detergent is critical as overly harsh conditions may denature the CbiM protein and disrupt its native conformation.

What are the technical challenges in expressing recombinant D. reducens CbiM protein?

Expressing recombinant D. reducens CbiM presents several technical challenges that researchers must address:

  • Membrane protein expression barriers:

    • Cytotoxicity due to overexpression of membrane proteins

    • Protein misfolding and aggregation

    • Insufficient membrane insertion machinery in heterologous hosts

  • Heterologous expression systems:

    • E. coli-based systems may lack proper chaperones for Gram-positive membrane proteins

    • Codon usage differences between D. reducens and common expression hosts

    • Potential toxic effects of cobalt transport proteins on host cells

  • Purification challenges:

    • Maintaining protein stability during extraction from membranes

    • Preserving native conformation during purification

    • Removing detergents without precipitating the protein

  • Functional assessment:

    • Developing assays to verify cobalt transport activity

    • Reconstituting the complete CbiMNQO complex for functional studies

Strategies to overcome these challenges include using specialized expression hosts (such as C43(DE3) E. coli strains), optimizing growth conditions, employing fusion tags that enhance solubility, and using directed evolution approaches to improve expression yields.

How does CbiM contribute to the metal reduction capabilities of D. reducens?

While CbiM primarily functions in cobalt transport, its role may indirectly impact the metal reduction capabilities of D. reducens through several mechanisms:

What structural characterization techniques are most effective for studying CbiM protein?

Advanced structural characterization of CbiM requires a multi-technique approach:

How can researchers investigate the interaction between CbiM and other components of the cobalt transport system?

To characterize the interactions between CbiM and other components of the CbiMNQO complex (CbiN, CbiQ, and CbiO), researchers can employ the following experimental approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of CbiM and potential interaction partners

    • Use antibodies against the tag to pull down protein complexes

    • Identify interacting proteins by mass spectrometry

  • Bacterial two-hybrid systems:

    • Adapt traditional two-hybrid approaches for membrane proteins

    • Use specialized systems like BACTH (Bacterial Adenylate Cyclase Two-Hybrid)

    • Quantify interactions through reporter gene expression

  • Förster Resonance Energy Transfer (FRET):

    • Label potential interaction partners with appropriate fluorophores

    • Measure energy transfer as an indicator of protein proximity

    • Can be performed in living cells to capture dynamic interactions

  • Cross-linking coupled with mass spectrometry:

    • Use chemical cross-linkers to stabilize transient interactions

    • Digest cross-linked complexes and analyze by LC-MS/MS

    • Identify cross-linked peptides to map interaction interfaces

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified CbiM on a sensor chip

    • Measure binding kinetics of other transport components

    • Determine association and dissociation constants

These approaches can reveal not only which proteins interact with CbiM but also the strength and dynamics of these interactions, providing insights into the assembly and function of the complete transport system.

What experimental approaches can determine how environmental conditions regulate cbiM gene expression?

Understanding the regulation of cbiM expression under different environmental conditions requires a combination of transcriptional, translational, and post-translational analyses:

  • Transcriptional analysis:

    • Quantitative PCR (qPCR) to measure cbiM mRNA levels under varying conditions

    • RNA-Seq for genome-wide expression patterns and co-regulated genes

    • Promoter-reporter fusion assays using fluorescent proteins or luciferase

  • Translational analysis:

    • Western blotting with CbiM-specific antibodies

    • Proteomics approaches similar to those used in D. reducens surfaceome studies

    • Ribosome profiling to assess translation efficiency

  • Experimental conditions to test:

    • Varying cobalt concentrations (limitation vs. excess)

    • Different electron acceptors (sulfate, Fe(III), etc.)

    • Growth with different carbon sources (lactate, pyruvate)

    • Oxygen exposure (stress response)

    • Presence of vitamin B12 (feedback regulation)

  • Regulatory mechanism investigation:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors

    • DNase footprinting to locate protein binding sites in the promoter region

    • CRISPR interference to validate regulatory elements

These approaches would allow researchers to construct a comprehensive model of how D. reducens regulates cbiM expression in response to environmental cues, particularly metal availability and redox conditions.

How does the function of CbiM in D. reducens compare to homologous proteins in other metal-reducing bacteria?

A comparative analysis of CbiM across different metal-reducing bacteria reveals important evolutionary and functional relationships:

OrganismCbiM Homology to D. reducensKey Functional DifferencesEcological Niche
Geobacter sulfurreducensModerate (35-45%)Potentially integrated with extensive c-type cytochrome network Fe(III)-reducing, electricity-producing
Shewanella oneidensisLow-Moderate (30-40%)May interact with MtrC/OmcA outer membrane cytochromes Versatile metal reducer, facultative anaerobe
Desulfovibrio speciesHigh (50-65%)Associated with tetraheme c3 cytochrome system Sulfate-reducing bacteria
Clostridium speciesHigh (60-75%)Similar core function, different regulatory mechanismsFermentative anaerobes

The differences in CbiM function across these organisms likely reflect adaptations to their specific ecological niches and electron transfer mechanisms. For instance, while D. reducens requires direct contact for Fe(III) reduction , Geobacter and Shewanella species have evolved elaborate extracellular electron transfer systems involving numerous c-type cytochromes .

Comparative genomic analyses could reveal how cobalt transport systems have co-evolved with metal reduction pathways, potentially highlighting unexplored connections between micronutrient acquisition and extracellular electron transfer capabilities.

What methodologies are most effective for assessing cobalt transport activity of recombinant CbiM?

To assess the cobalt transport activity of recombinant CbiM, researchers can employ several complementary methodologies:

  • Radioactive transport assays:

    • Use ⁵⁷Co or ⁶⁰Co as tracers

    • Measure uptake kinetics in whole cells or membrane vesicles

    • Determine transport parameters (Km, Vmax)

  • Metal-responsive fluorescent probes:

    • Load cells with cobalt-sensitive fluorescent dyes

    • Monitor intracellular cobalt accumulation in real-time

    • Allows for single-cell analysis of transport heterogeneity

  • Isothermal Titration Calorimetry (ITC):

    • Measure binding thermodynamics of cobalt to purified CbiM

    • Determine binding stoichiometry and affinity constants

    • Assess effects of mutations on binding properties

  • Proteoliposome reconstitution assays:

    • Reconstitute purified CbiM (with CbiN, CbiQ, and CbiO) in liposomes

    • Create ion gradients to drive transport

    • Measure cobalt accumulation inside vesicles

  • Competition assays:

    • Use structural analogs or other divalent metals

    • Determine transport specificity and potential inhibitors

    • Identify physiologically relevant competing ions

  • Growth complementation:

    • Express D. reducens CbiM in cobalt transport-deficient strains

    • Assess growth restoration under cobalt-limited conditions

    • Provides functional evidence in vivo

These methods provide a comprehensive assessment of CbiM function, from binding parameters to transport kinetics, allowing researchers to build a detailed model of how this protein contributes to cobalt homeostasis in D. reducens.

What are the implications of CbiM research for understanding metal cycling in anaerobic environments?

Research on CbiM in D. reducens has broader implications for understanding biogeochemical cycling in anaerobic environments:

  • The cobalt transport systems of metal-reducing bacteria like D. reducens play crucial roles in acquiring essential micronutrients in metal-rich but bioavailable-metal-poor environments.

  • By maintaining proper cellular metabolism through cobalt homeostasis, CbiM indirectly supports the metal reduction capabilities that allow D. reducens to influence the speciation and mobility of metals in anaerobic sediments.

  • Understanding the molecular mechanisms of metal transport provides insights into how anaerobic bacteria adapt to and potentially influence their geochemical environments.

  • The connection between micronutrient acquisition systems and metal reduction pathways represents an important but understudied aspect of microbial ecology in anaerobic settings.

Future research should explore the regulatory networks that coordinate expression of cobalt transport genes with metal reduction pathways, potentially revealing new mechanisms by which anaerobic bacteria sense and respond to their geochemical environment.

How can CbiM research contribute to biotechnological applications of D. reducens?

The study of CbiM has several potential biotechnological applications:

  • Bioremediation optimization:

    • Engineering strains with enhanced cobalt transport for improved growth in contaminated environments

    • Developing biosensors based on CbiM regulation to detect bioavailable cobalt

    • Understanding how micronutrient availability limits bioremediation efficacy

  • Synthetic biology applications:

    • Incorporating D. reducens CbiM into designer microbes for specific metal capture

    • Creating tunable cobalt transport systems for controlled vitamin B12 production

    • Developing metal-responsive genetic circuits using CbiM regulatory elements

  • Protein engineering opportunities:

    • Modifying CbiM specificity to transport other metals of interest

    • Creating chimeric transporters with novel functions

    • Developing CbiM variants with improved stability for structural studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.