Recombinant Desulfotomaculum reducens Glycerol-3-phosphate acyltransferase (plsY)

What is the functional role of glycerol-3-phosphate acyltransferase (plsY) in Desulfotomaculum reducens?

Glycerol-3-phosphate acyltransferase (plsY) in D. reducens functions as a critical enzyme in phospholipid biosynthesis, catalyzing the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate to form lysophosphatidic acid. This represents the first step in the phospholipid biosynthetic pathway. In D. reducens, which is a Gram-positive, sulfate-reducing bacterium also capable of reducing Fe(III), the plsY enzyme (UniProt ID: A4J3P2) consists of 200 amino acids and is encoded by the plsY gene (Dred_1161). The enzyme's activity is essential for membrane lipid formation, which is particularly important in this bacterium given its specialized metabolic capabilities related to metal reduction that require precise membrane composition and integrity . Unlike eukaryotic systems that primarily use the Kennedy pathway for phospholipid synthesis, bacterial systems including D. reducens utilize plsY as part of the bacterial phospholipid synthesis pathway.

How does the amino acid sequence of D. reducens plsY contribute to its function?

The amino acid sequence of D. reducens plsY (200 amino acids in length) contains several structural features that contribute to its function as an acyltransferase. The complete sequence (MVHITTVMIIIGAYLIGSIPFGFLLAYFWKGIDIRKCGSGNIGATNVWRTLGKVPGMIVLILDMIKGISAVLLAKQLENTDIAVLGVALAVMAGHSWPLWLRFKGGKIIATGAGAILALSPMPLLLAFLVWLTTVVVSRYVSLGSILGAVSLPIWMALLNQNRHYLIFSVLVASFAVWKHSSNIGRLIKGTEFKIGQKKT) reveals hydrophobic regions consistent with a membrane-associated protein . The sequence contains a conserved acyltransferase domain with the characteristic signature motif found in other bacterial plsY proteins. The N-terminal region appears to contain transmembrane helices, which anchor the protein to the bacterial cell membrane where phospholipid synthesis occurs. The central region contains the catalytic domain responsible for the acyltransferase activity. This structural organization allows the enzyme to access both the cytoplasmic substrate pools and the membrane environment where its products are incorporated.

What experimental approaches are recommended for optimizing recombinant D. reducens plsY expression?

For optimal expression of recombinant D. reducens plsY, researchers should consider a systematic approach addressing several key parameters. The protein is typically expressed in E. coli with an N-terminal His-tag to facilitate purification . Researchers should optimize:

• Expression system selection: While E. coli is commonly used, alternative systems may be considered for specific experimental needs.

• Induction conditions: Optimize IPTG concentration (typically 0.1-1.0 mM), induction temperature (often lowered to 16-25°C for membrane proteins), and duration (4-24 hours).

• Cell lysis: Given the membrane-associated nature of plsY, effective cell disruption using sonication or pressure-based methods followed by membrane solubilization with appropriate detergents is critical.

• Protein purification: Immobilized metal affinity chromatography (IMAC) utilizing the His-tag is effective, followed by size exclusion chromatography for higher purity.

• Storage conditions: The purified protein is most stable when stored at -20°C/-80°C in a buffer containing 50% glycerol to prevent freeze-thaw damage .

For reconstitution, centrifuge the lyophilized protein vial before opening, and reconstitute in deionized sterile water to 0.1-1.0 mg/mL, adding glycerol (5-50% final concentration) for long-term storage stability .

What analytical techniques are most suitable for confirming the purity and activity of recombinant D. reducens plsY?

Multiple complementary analytical techniques should be employed to confirm both purity and activity of recombinant D. reducens plsY:

For purity assessment:

• SDS-PAGE: Should show >90% purity with a single band at approximately 22 kDa .

• Western blotting: Using anti-His antibodies to confirm identity of the recombinant protein.

• Mass spectrometry: For accurate molecular weight determination and peptide fingerprinting to confirm sequence identity.

For activity assessment:

• Acyltransferase activity assay: Measure the rate of acyl transfer from acyl-phosphate to glycerol-3-phosphate using either:

  • Radiometric assays with labeled substrates

  • Spectrophotometric coupled enzyme assays tracking either substrate consumption or product formation

  • HPLC or LC-MS methods to directly quantify lysophosphatidic acid formation

• Thermal shift assays: To assess protein stability and folding under different buffer conditions.

These methods together provide comprehensive characterization of the recombinant enzyme's physical and biochemical properties, ensuring it is suitable for downstream applications in structural or functional studies.

How does D. reducens plsY structure and function compare with homologous enzymes from other bacterial species?

D. reducens plsY represents an important member of the bacterial acyltransferase family, with distinctive features when compared to homologs from other species. Comparative analysis reveals:

Unlike plant GPAT enzymes, which can possess dual acyltransferase/phosphatase activity and different regiospecificities (sn-1 vs sn-2) , bacterial plsY proteins like that from D. reducens typically exhibit only acyltransferase activity with sn-1 regiospecificity. This fundamental difference underscores the evolutionary divergence between prokaryotic and eukaryotic phospholipid synthesis pathways. The amino acid sequence of D. reducens plsY shows key conserved motifs with other bacterial plsY enzymes, but also contains unique regions that may relate to its function in this metal-reducing bacterium.

What is the potential relationship between D. reducens plsY activity and the organism's metal reduction capabilities?

The potential relationship between D. reducens plsY activity and the organism's metal reduction capabilities represents an intriguing research question that connects membrane biology to electron transfer mechanisms. Several hypotheses can be proposed:

• Membrane composition influence: As plsY catalyzes the first committed step in phospholipid synthesis, it directly influences membrane composition. D. reducens requires specific membrane properties for electron transfer to extracellular metal acceptors. Research on D. reducens has demonstrated that direct surface contact is necessary for cells to transfer electrons to extracellular electron acceptors . The surfaceome investigation of D. reducens revealed multiple redox-active proteins potentially involved in Fe(III) reduction, including a membrane-bound hydrogenase 4Fe-4S cluster subunit (Dred_0462), a heterodisulfide reductase subunit A (Dred_0143), and a thiol-disulfide oxidoreductase (Dred_1533) . The proper localization and function of these proteins likely depend on specific membrane properties determined in part by plsY activity.

• Electron transport chain integration: Membrane phospholipids form the matrix in which electron transport components are embedded. Alterations in plsY activity could affect the organization and efficiency of electron transport to extracellular acceptors like Fe(III).

• Stress response adaptation: Metal reduction often occurs under anaerobic or otherwise stressful conditions. PlsY activity may be regulated to adjust membrane properties in response to these environmental stresses.

Experimental approaches to investigate these connections could include creating conditional plsY mutants and assessing their metal reduction capabilities, or analyzing membrane phospholipid composition under different metal-reducing conditions.

What advanced structural biology techniques are most informative for studying D. reducens plsY?

Given the membrane-associated nature of D. reducens plsY, a multi-technique structural biology approach is recommended:

• X-ray crystallography: Challenging for membrane proteins but potentially achievable using:

  • Lipidic cubic phase crystallization

  • Crystallization with appropriate detergents

  • Co-crystallization with substrate analogs or inhibitors

  • Surface engineering to improve crystal contacts

• Cryo-electron microscopy (cryo-EM): Particularly single-particle analysis, which has revolutionized membrane protein structural biology by:

  • Enabling visualization in near-native environments

  • Requiring smaller sample amounts than crystallography

  • Allowing visualization of different conformational states

• Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Solution NMR for studying dynamics of soluble domains

  • Solid-state NMR for full-length protein in membrane mimetics

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • For mapping solvent accessibility and conformational changes

  • Particularly useful for studying substrate binding events

• Molecular dynamics simulations:

  • To model protein behavior in membrane environments

  • To predict substrate binding mechanisms and conformational changes

These approaches would provide complementary information about the enzyme's structure-function relationships, potentially revealing the molecular basis for its catalytic mechanism and substrate specificity.

How can site-directed mutagenesis be effectively employed to study catalytic mechanisms of D. reducens plsY?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of D. reducens plsY. An effective research strategy would:

• Identify candidate residues for mutation based on:

  • Sequence alignment with characterized plsY enzymes from other organisms

  • Structural predictions highlighting potential catalytic or substrate-binding residues

  • Conserved motifs in the acyltransferase family

• Design mutation types based on mechanistic hypotheses:

  • Conservative substitutions (e.g., Asp→Glu) to test size constraints

  • Charge neutralization or reversal to test electrostatic requirements

  • Removal of functional groups (e.g., Ser→Ala) to test specific chemical roles

• Employ a systematic mutagenesis workflow:

  • Use overlap extension PCR or commercial site-directed mutagenesis kits

  • Confirm mutations by sequencing before expression

  • Express and purify mutant proteins using identical conditions to wild-type

  • Compare expression levels, stability, and solubility to wild-type

• Characterize mutant enzymes through:

  • Steady-state kinetic analysis (kcat, Km) with various substrates

  • Substrate specificity profiling

  • pH-rate profiles to identify ionizable catalytic residues

  • Thermal stability comparisons

This approach would systematically map the roles of specific amino acids in substrate binding, catalysis, and structural integrity, ultimately elucidating the enzyme's reaction mechanism.

What are the most effective approaches for studying the in vivo function of plsY in D. reducens?

• Conditional gene expression systems:

  • Develop inducible promoter systems for D. reducens

  • Create depleted strains where plsY expression can be controlled by an exogenous inducer

  • Monitor physiological effects during depletion/induction cycles

• Genetic complementation studies:

  • Generate partial loss-of-function mutants

  • Complement with wild-type or modified plsY variants

  • Assess restoration of growth and metal reduction phenotypes

• Metabolic labeling and lipidomics:

  • Use isotopically labeled precursors to track phospholipid synthesis

  • Apply lipidomics approaches to characterize membrane composition changes

  • Correlate membrane composition with growth and metal reduction capabilities

• Protein-protein interaction studies:

  • Employ bacterial two-hybrid systems or pull-down assays

  • Identify interaction partners that may connect plsY to other cellular processes

  • Focus on potential interactions with components of electron transport chains

• Growth condition analysis:

  • Compare plsY expression and activity across different growth conditions

  • Particularly examine expression during Fe(III) reduction with lactate as electron donor

  • Assess correlation between plsY activity and metal reduction rates

D. reducens can reduce both soluble [Fe(III)-citrate] and insoluble (hydrous ferric oxide, HFO) forms of Fe(III), but requires direct contact for reduction of physically inaccessible HFO . This suggests that membrane composition, potentially influenced by plsY activity, may be critical for the surface exposure of reductases involved in electron transfer to extracellular acceptors.

What are the optimal storage and handling conditions for maintaining activity of recombinant D. reducens plsY?

Maintaining the activity of recombinant D. reducens plsY requires careful attention to storage and handling conditions due to its membrane-associated nature. Based on established protocols for similar proteins, researchers should follow these guidelines:

• Short-term storage (1-7 days):

  • Store at 4°C in appropriate buffer

  • Avoid repeated freeze-thaw cycles

  • Keep protein concentration at 0.1-1.0 mg/mL

• Long-term storage:

  • Store at -20°C/-80°C with glycerol added as cryoprotectant

  • The recommended final glycerol concentration is 50%

  • Aliquot before freezing to avoid repeated freeze-thaw cycles

• Buffer composition considerations:

  • Use Tris/PBS-based buffer at pH 8.0 with 6% trehalose

  • Include appropriate detergents at concentrations above their critical micelle concentration

  • Consider adding reducing agents like DTT (1-5 mM) to prevent oxidation of thiol groups

• Handling during experiments:

  • Maintain protein samples on ice when working

  • Centrifuge briefly before opening vials to collect condensation

  • Use low-retention microcentrifuge tubes and pipette tips

Adherence to these guidelines will help maintain enzyme structure and activity, ensuring reliable experimental results across extended research periods.

How can researchers effectively develop specific antibodies against D. reducens plsY for immunological studies?

Developing specific antibodies against D. reducens plsY requires a strategic approach accounting for its membrane protein nature. The following comprehensive methodology is recommended:

• Antigen selection and preparation:

  • Use the full-length recombinant His-tagged protein for generating antibodies against multiple epitopes

  • Alternatively, identify hydrophilic, surface-exposed regions through computational prediction for peptide antibody production

  • For the full-length protein, ensure proper solubilization using mild detergents

• Immunization strategy:

  • Select either rabbit polyclonal antibodies (for broad epitope recognition) or mouse monoclonal antibodies (for specificity)

  • Use adjuvants appropriate for membrane proteins

  • Employ a longer immunization schedule with multiple boosts to enhance affinity

• Antibody purification and validation:

  • Purify antibodies using affinity chromatography with immobilized antigen

  • Perform cross-adsorption against E. coli lysates to remove antibodies recognizing the expression host proteins

  • Validate specificity using:

    • Western blotting against both recombinant protein and D. reducens lysates

    • Immunoprecipitation followed by mass spectrometry

    • Competitive binding assays with free antigen

• Application optimization:

  • Determine optimal antibody dilutions for different applications (Western blot, immunoprecipitation, immunofluorescence)

  • Establish appropriate blocking conditions to minimize background

  • Optimize fixation and permeabilization protocols for immunolocalization studies

These antibodies would enable studies of natural plsY expression levels, subcellular localization, and potential protein-protein interactions in various growth conditions, particularly during metal reduction.

What are the key considerations for designing enzyme assays to measure D. reducens plsY activity accurately?

Designing accurate enzyme assays for D. reducens plsY activity requires careful consideration of its catalytic properties and the chemical nature of its substrates and products. A comprehensive approach should address:

• Substrate preparation and handling:

  • Acyl-phosphate substrates are chemically unstable and must be freshly prepared

  • Glycerol-3-phosphate should be of high purity

  • Consider testing substrate specificity using acyl chains of varying lengths and saturation

• Reaction conditions optimization:

  • Buffer composition: Test different buffers (HEPES, Tris, phosphate) at pH range 6.5-8.5

  • Ionic strength: Optimize salt concentration (typically 50-200 mM)

  • Divalent cation requirements: Test effects of Mg²⁺, Mn²⁺, or Ca²⁺ (0.5-10 mM)

  • Detergent selection: Critical for maintaining enzyme in active form

• Detection method selection:

  Method	Advantages	Limitations	Considerations
  Radiometric	High sensitivity, direct measurement	Requires radioactive materials	Use ¹⁴C-glycerol-3-phosphate
  Spectrophotometric	Real-time monitoring, no radioactivity	Indirect, potential interference	Couple to reactions that produce detectable signals
  HPLC/LC-MS	Direct product quantification, high specificity	Equipment intensive, not real-time	Requires product standards

• Controls and validation:

  • Include no-enzyme controls to account for non-enzymatic acyl-phosphate hydrolysis

  • Use heat-inactivated enzyme as negative control

  • Validate with known inhibitors or by testing pH-dependence profiles

  • Ensure linearity with respect to time and enzyme concentration

• Data analysis considerations:

  • Account for substrate depletion in extended assays

  • Consider potential product inhibition

  • Use appropriate enzyme kinetic models (Michaelis-Menten or more complex)

These considerations will ensure development of robust, reproducible assays that accurately reflect the enzyme's true catalytic properties.

How does bacterial plsY from D. reducens differ functionally from eukaryotic GPAT enzymes?

Bacterial plsY from D. reducens and eukaryotic GPAT enzymes represent evolutionarily distinct solutions to catalyzing the first step of phospholipid biosynthesis, with significant differences in structure, function, and regulation:

• Structural organization:

  • D. reducens plsY: Single domain protein of 200 amino acids with membrane-spanning regions

  • Eukaryotic GPATs: Larger multi-domain proteins, often with separate regulatory domains

• Substrate utilization:

  • D. reducens plsY: Uses acyl-phosphate as the acyl donor

  • Eukaryotic GPATs: Utilize acyl-CoA as the acyl donor

  • This fundamental difference reflects distinct evolutionary pathways and energy coupling mechanisms

• Regiospecificity:

  • D. reducens plsY: Likely exhibits sn-1 regiospecificity (typical of bacterial enzymes)

  • Eukaryotic GPATs: Show diverse regiospecificities; some plant GPATs (e.g., GPAT4, GPAT6, GPAT8) exhibit sn-2 regiospecificity

• Enzymatic activities:

  • D. reducens plsY: Monofunctional acyltransferase

  • Some plant GPATs: Bifunctional enzymes with both acyltransferase and phosphatase activities, producing 2-monoacylglycerol products

• Substrate preferences:

  • Plant GPATs (GPAT4, GPAT6, GPAT8): Strong preference for C16:0 and C18:1 ω-oxidized acyl-CoAs

  • Other plant GPATs (GPAT5): Accommodate broad chain length range of ω-oxidized and unsubstituted acyl-CoAs

  • Bacterial plsY: Generally prefer saturated and monounsaturated medium-chain acyl groups

These differences highlight the diverse evolutionary solutions to phospholipid biosynthesis across domains of life and suggest potential biotechnological applications exploiting these distinct mechanisms.

What insights can comparative genomics provide about the evolution and conservation of plsY across bacterial species?

Comparative genomics analysis of plsY genes across bacterial species reveals important insights into evolution, conservation, and adaptation patterns:

• Phylogenetic distribution:

  • PlsY is widely distributed across diverse bacterial phyla

  • Present in both Gram-positive bacteria (like D. reducens) and Gram-negative bacteria

  • The gene appears to be essential in most bacterial species, indicating its fundamental role

• Sequence conservation patterns:

  • Core catalytic domain shows high conservation across species

  • Membrane-spanning regions show greater sequence divergence

  • Substrate binding regions show adaptation to species-specific lipid preferences

• Genomic context:

  • In many bacteria, plsY is located in operons with other phospholipid biosynthesis genes

  • In D. reducens, the plsY gene (Dred_1161) genomic context may provide clues about its regulation and functional relationships

  • Synteny analysis across species reveals evolutionary patterns in the organization of lipid biosynthesis pathways

• Horizontal gene transfer assessment:

  • Analysis of GC content, codon usage bias, and phylogenetic incongruence can reveal potential horizontal gene transfer events

  • Such events might explain specialized adaptations in certain bacterial lineages

• Correlation with bacterial ecology:

  • Organisms from similar environments (e.g., metal-rich anaerobic habitats) may show convergent adaptations in plsY sequence

  • Comparing D. reducens plsY with homologs from other metal-reducing bacteria could reveal environment-specific adaptations

This comparative approach provides context for understanding D. reducens plsY within the broader evolutionary landscape of bacterial phospholipid biosynthesis and may reveal specialized adaptations related to its metal-reducing lifestyle.

How can recombinant D. reducens plsY be utilized in structural biology studies of membrane proteins?

Recombinant D. reducens plsY offers several valuable applications in advancing structural biology studies of membrane proteins:

• Model system development:

  • As a relatively small (200 amino acids) bacterial membrane protein, D. reducens plsY represents an accessible model system for developing membrane protein structural biology techniques

  • The availability of recombinant protein with high purity (>90%) facilitates structural studies

• Membrane protein crystallization methodology:

  • Can serve as a test case for optimizing lipidic cubic phase crystallization approaches

  • Allows evaluation of different detergents and stabilizing agents for membrane protein crystallization

  • The His-tag enables oriented immobilization for crystallization trials

• Integration with emerging structural techniques:

  • Target for micro-electron diffraction (microED) studies

  • Model for developing improved single-particle cryo-EM approaches for small membrane proteins

  • Test case for integrative structural biology combining multiple techniques

• Structure-function relationship studies:

  • Template for designing chimeric proteins to probe the structural basis of substrate specificity

  • Platform for testing computational predictions about membrane protein folding and stability

  • Model for studying lipid-protein interactions in a native-like environment

• Method development for membrane mimetics:

  • Evaluation platform for various membrane mimetic systems (nanodiscs, amphipols, SMALPs)

  • Comparison of protein behavior in different reconstitution environments

These applications extend beyond understanding this specific enzyme to advancing the broader field of membrane protein structural biology, which remains challenging despite recent technological advances.

What potential biotechnological applications exist for D. reducens plsY in synthetic biology approaches?

D. reducens plsY offers several promising biotechnological applications in synthetic biology approaches:

• Designer phospholipid production:

  • Engineering plsY variants with altered substrate specificity could enable production of novel phospholipids

  • Integration into cell-free systems for production of specialized phospholipids for pharmaceutical applications

  • Creation of artificial minimal cells with tailored membrane compositions

• Bioremediation enhancement:

  • D. reducens is a metal-reducing bacterium capable of reducing both soluble [Fe(III)-citrate] and insoluble (hydrous ferric oxide, HFO) forms of Fe(III)

  • Engineering plsY to optimize membrane composition could enhance electron transfer capabilities

  • Improved variants could increase metal reduction rates for bioremediation of contaminated environments

• Biosensor development:

  • PlsY activity is essential for membrane formation

  • Creating reporter systems linked to plsY function could enable biosensors for environmental conditions

  • Potential applications in detecting metal contaminants in environmental samples

• Synthetic biology toolkit expansion:

  • PlsY represents a modular component for membrane engineering

  • Could be incorporated into synthetic biology circuits affecting membrane properties

  • Potential as an orthogonal system for synthetic cell engineering

• Industrial enzyme applications:

  • The enzyme's ability to function under anaerobic conditions makes it suitable for certain industrial processes

  • Potential applications in green chemistry approaches to lipid modification

  • Could serve as a template for engineering industrial acyltransferases with novel properties

These applications leverage the unique properties of D. reducens plsY within a synthetic biology framework to address various biotechnological challenges.

What are the current knowledge gaps in understanding D. reducens plsY function and how might future research address them?

Despite significant advances in understanding D. reducens plsY, several critical knowledge gaps remain that warrant further investigation:

• Structure-function relationships:

  • No high-resolution structure is currently available for D. reducens plsY

  • The precise catalytic mechanism remains speculative

  • Future research should prioritize structural determination through X-ray crystallography, cryo-EM, or NMR approaches, potentially leveraging the availability of recombinant protein

• Regulatory mechanisms:

  • How plsY expression and activity are regulated in response to growth conditions

  • Whether post-translational modifications affect enzyme function

  • Targeted transcriptomics and proteomics studies comparing different growth conditions (particularly comparing sulfate reduction vs. Fe(III) reduction) would provide valuable insights

• Connection to metal reduction:

  • The potential role of plsY-dependent membrane composition in electron transfer to metals

  • Whether membrane phospholipid composition changes during adaptation to metal reduction

  • Future research integrating lipidomics with electron transfer studies could elucidate these connections

• In vivo dynamics:

  • Subcellular localization and potential protein-protein interactions

  • Membrane domain formation and potential co-localization with electron transport components

  • Advanced imaging techniques combined with protein interaction studies would address these questions

• Evolutionary adaptations:

  • How D. reducens plsY has evolved specific features related to the organism's metal-reducing lifestyle

  • Whether horizontal gene transfer has played a role in its evolution

  • Comparative genomics and phylogenetic analyses across metal-reducing bacteria would provide evolutionary context

Addressing these knowledge gaps will require multidisciplinary approaches combining structural biology, biochemistry, genetics, systems biology, and biophysics. Research in this area not only advances understanding of this specific enzyme but also contributes to broader knowledge of bacterial membrane biology and metal reduction processes.

How might advances in synthetic biology and protein engineering expand applications of D. reducens plsY?

The integration of synthetic biology and protein engineering approaches with D. reducens plsY research offers exciting prospects for novel applications and expanded fundamental understanding:

• Directed evolution for enhanced properties:

  • Development of plsY variants with increased stability or activity

  • Selection for variants with altered substrate specificity for novel phospholipid production

  • Creation of variants optimized for heterologous expression in biotechnological hosts

• Circuit integration in synthetic biology:

  • Incorporation of plsY into synthetic genetic circuits responsive to environmental signals

  • Development of tunable membrane composition systems for synthetic cells

  • Creation of feedback loops connecting membrane properties to cellular functions

• Domain swapping and chimeric proteins:

  • Engineering fusion proteins combining plsY with other enzymatic domains

  • Creating chimeric proteins with domains from other bacterial or eukaryotic acyltransferases

  • Developing bifunctional enzymes with both acyltransferase and phosphatase activities similar to plant GPATs

• Minimal cell applications:

  • Integration into minimal cell designs for simplified phospholipid biosynthesis

  • Engineering orthogonal membrane synthesis pathways

  • Development of artificial cells with programmable membrane properties

• Applied bioremediation systems:

  • Engineering bacterial systems with optimized plsY-dependent membrane properties for enhanced metal reduction

  • Development of immobilized enzyme systems for bioremediation applications

  • Creation of cell-free systems leveraging plsY activity for environmental applications