Recombinant Desulfotomaculum reducens NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Desulfotomaculum reducens and NADH-Quinone Oxidoreductase

Desulfotomaculum reducens MI-1 is a Gram-positive, spore-forming, sulfate- and metal-reducing bacterium that has been extensively studied for its ability to reduce various metals, including uranium . This organism possesses remarkable metabolic versatility, capable of both fermentative growth and respiratory processes utilizing various electron acceptors.

NADH-quinone oxidoreductase (NADH-QOR) constitutes a fundamental component of the respiratory electron transport chain in many prokaryotes, catalyzing the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane to generate a proton motive force. In D. reducens, the NADH-QOR complex comprises 11 identified subunits, with the nuoA gene (designated as dred_2046) encoding the subunit A of this complex .

Significance of nuoA in Metal Reduction

The nuoA subunit plays a crucial role in the functionality of the NADH-QOR complex. Transcriptomic studies have revealed that nuoA, along with other components of the NADH-QOR complex, is significantly upregulated during both sulfate reduction and uranium exposure . This observation suggests that the NADH-QOR complex, including nuoA, is actively involved in the respiratory processes that facilitate electron transfer to these terminal electron acceptors.

Discovery and Characterization

Initial characterization of D. reducens revealed its capacity for metal reduction, with subsequent genomic and transcriptomic analyses identifying the nuoA gene as part of the NADH-QOR gene cluster (dred_2036 to dred_2046) . The upregulation of this gene cluster during exposure to uranium has provided valuable insights into the mechanisms underlying metal reduction in this organism.

Genetic Organization

The nuoA gene is designated as dred_2046 in the D. reducens genome and forms part of the NADH-QOR gene cluster (dred_2036 to dred_2046) . This genomic organization reflects the functional integration of nuoA within the larger NADH-QOR complex, which catalyzes the initial step in the respiratory electron transport chain.

Protein Identification and Classification

The nuoA protein has been assigned the UniProt ID A4J660 and is also known by several synonyms, including NADH dehydrogenase I subunit A and NDH-1 subunit A . These designations reflect its functional role as a component of complex I in the respiratory electron transport chain.

Recombinant Expression and Purification

The availability of recombinant nuoA protein has facilitated detailed investigations into its structure, function, and potential applications.

Expression Systems

Recombinant nuoA has been successfully expressed in Escherichia coli expression systems, with the full-length protein (amino acids 1-117) typically fused to an N-terminal His tag to facilitate purification . This expression system allows for the production of sufficient quantities of the protein for biochemical and structural analyses.

Purification and Quality Control

The purification process for recombinant nuoA typically involves affinity chromatography leveraging the His tag, followed by additional purification steps to achieve high purity. Quality control measures include SDS-PAGE analysis to confirm purity and molecular weight, as well as functional assays to verify the protein's activity .

Functional Role in Cellular Metabolism

The nuoA protein plays a critical role in the respiratory metabolism of D. reducens, particularly in processes involving electron transfer to various terminal electron acceptors.

Role in Electron Transport Chain

As a component of the NADH-QOR complex, nuoA participates in the transfer of electrons from NADH to quinones within the respiratory electron transport chain. This process is coupled to the translocation of protons across the membrane, contributing to the generation of a proton motive force that drives ATP synthesis through oxidative phosphorylation .

Involvement in Uranium Reduction

Transcriptomic analyses have revealed significant upregulation of the nuoA gene, along with other components of the NADH-QOR complex, during exposure to uranium(VI) . This finding suggests that the NADH-QOR complex, including nuoA, plays a role in the reduction of uranium by D. reducens, possibly by facilitating electron transfer to this metal.

Differential Expression Patterns

The expression of nuoA exhibits distinctive patterns in response to different growth conditions. While the gene is highly expressed during sulfate reduction, its upregulation during pyruvate fermentation in the presence of uranium(VI) is particularly noteworthy . This observation indicates that electrons are being shuttled through the electron transport chain even during fermentative growth when uranium is present, suggesting that uranium reduction represents an active metabolic process rather than merely a toxicity response.

Table 1: Expression Patterns of nuoA Under Different Growth Conditions

Growth ConditionExpression LevelFunctional Implication
Sulfate ReductionHighInvolved in respiratory electron transport
Pyruvate FermentationLowLimited role in fermentative metabolism
Pyruvate Fermentation with U(VI)HighPotential involvement in uranium reduction

Applications in Environmental Biotechnology

The study of recombinant nuoA protein has significant implications for various environmental biotechnology applications, particularly in the fields of bioremediation and metal recovery.

Bioremediation of Uranium-Contaminated Sites

The involvement of nuoA in uranium reduction suggests potential applications in the bioremediation of uranium-contaminated environments. By understanding the molecular mechanisms underlying uranium reduction by D. reducens, researchers can develop more effective strategies for the microbial remediation of such sites .

Protein Engineering for Enhanced Metal Reduction

Knowledge of the structure and function of nuoA opens possibilities for protein engineering approaches aimed at enhancing metal reduction capabilities. Such engineered proteins could potentially be employed in environmental remediation or recovery of valuable metals from waste streams.

Bioelectrochemical Systems

The electron transfer capabilities associated with nuoA and the NADH-QOR complex suggest potential applications in bioelectrochemical systems, such as microbial fuel cells or biosensors for metal detection. These applications leverage the protein's ability to participate in extracellular electron transfer processes.

Reconstitution Protocols

For optimal results, it is recommended that the lyophilized protein be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% is advisable for long-term storage, with 50% being the standard recommendation .

Future Research Directions

Future research on recombinant nuoA may focus on several promising directions:

  1. Detailed structural analysis through techniques such as X-ray crystallography or cryo-electron microscopy to elucidate the three-dimensional structure of the protein and its interactions within the NADH-QOR complex.

  2. Investigation of the protein's specific role in the electron transfer pathways leading to uranium reduction, potentially through site-directed mutagenesis and functional assays.

  3. Exploration of the protein's potential applications in environmental biotechnology, including the development of engineered variants with enhanced metal reduction capabilities.

  4. Comparative analysis with homologous proteins from other metal-reducing bacteria to identify conserved features and functional adaptations specific to D. reducens.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling any special format requirements. Please indicate your preference in the order notes, and we will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoA; Dred_2046; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Desulfotomaculum reducens (strain MI-1)
Target Names
nuoA
Target Protein Sequence
MSDWIGVALFIVVGIVFGAGGMLTSFLIHPRSKNKFKLETYECGLPTEGATWVRFKTQYF TYALMFVIFDVEVIYLYPWAVSFVDLGLAGLIKMFLFIFILVLGLWYAWKEGALEWK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the enzyme's immediate electron acceptor is believed to be a menaquinone. It couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Desulfotomaculum reducens MI-1 and why is it significant for NADH-quinone oxidoreductase studies?

Desulfotomaculum reducens MI-1 is a metabolically versatile Gram-positive bacterium and metal reducer that has become an important model organism for studying electron transport chains in Gram-positive bacteria. Unlike the extensively studied Gram-negative bacteria, D. reducens offers unique insights into alternative electron transfer mechanisms. The organism is particularly significant because it can thrive across multiple cultivation conditions including sulfate reduction, soluble Fe(III) reduction, insoluble Fe(III) reduction, and pyruvate fermentation, making it an excellent system for studying differential expression of respiratory complexes . Proteomic studies have revealed only about 38% of its genome-encoded proteins across these different growth conditions, suggesting many components remain poorly characterized .

What is the structure and composition of bacterial NADH-quinone oxidoreductase compared to mitochondrial Complex I?

Bacterial NADH-quinone oxidoreductase (NDH-1) is structurally simpler than its mammalian counterpart. While mammalian mitochondrial Complex I contains more than 40 subunits, bacterial NDH-1 in organisms such as Paracoccus denitrificans and Thermus thermophilus HB-8 consists of only 14 subunits . This structural simplicity makes bacterial systems valuable models for understanding the core functions of this enzyme complex. The NuoA subunit is one of these core components, functioning within the membrane domain of the complex. Despite the structural differences, both bacterial and mitochondrial complexes perform the crucial function of coupling electron transfer from NADH to quinone with proton translocation across the membrane .

What role does the nuoA subunit play in the NADH-quinone oxidoreductase complex?

The nuoA subunit is a membrane-embedded component of the NADH-quinone oxidoreductase complex. While not directly involved in the catalytic conversion of NADH to NAD+, it plays a crucial structural role in the membrane domain of the complex. It contributes to proton translocation activities and maintains the structural integrity necessary for electron transfer from the hydrophilic arm to the quinone-binding site. Studies of related organisms suggest that nuoA facilitates the connection between the electron transport components and the proton-pumping machinery, ensuring proper energy conservation during respiration . The specific characteristics of D. reducens nuoA may differ from model organisms, potentially adapting to this bacterium's unique metabolic versatility.

What are the optimal expression systems for producing recombinant D. reducens nuoA?

For successful expression of recombinant D. reducens nuoA, researchers should consider several expression systems with specific modifications for membrane proteins:

  • E. coli-based expression:

    • BL21(DE3) strains with modifications for membrane protein expression (C41, C43)

    • Expression vector containing T7 promoter with appropriate fusion tags (His6, Strep-tag II)

    • Lowering induction temperature to 16-20°C

    • Using mild inducers (0.1-0.5 mM IPTG)

    • Including membrane-stabilizing additives (glycerol 5-10%)

  • Cell-free expression systems:

    • Particularly useful for membrane proteins that may be toxic to host cells

    • Allows direct incorporation into nanodiscs or liposomes

    • Enables rapid screening of expression conditions

While specific expression data for D. reducens nuoA is limited, comparative analysis suggests using conditions that have been successful with other membrane-embedded oxidoreductase components .

What purification challenges are specific to D. reducens nuoA and how can they be addressed?

Purification of membrane proteins like nuoA presents several challenges:

ChallengeSolutionRationale
Low solubilityUse gentle detergents (DDM, LMNG)Maintains protein structure while removing from membrane
Protein instabilityInclude stabilizing agents (glycerol, specific lipids)Mimics native membrane environment
Co-purification contaminantsTwo-stage purification (affinity + size exclusion)Increases purity while maintaining function
Loss of activityReconstitute in proteoliposomesRestores native-like environment
AggregationUse on-column detergent exchangeGradual transition between detergent environments

For D. reducens nuoA specifically, research should account for the Gram-positive membrane composition when selecting detergents and stabilizing agents. Proteomic studies indicate potential interactions with other subunits, suggesting that co-expression with partner proteins may improve stability and function .

How does the electron transfer mechanism in D. reducens NADH-quinone oxidoreductase differ from model organisms?

The electron transfer mechanism in D. reducens presents several distinctions worth investigating:

  • Alternative electron acceptors: Unlike conventional model organisms, D. reducens can couple electron transport to various terminal acceptors including sulfate and Fe(III), suggesting specialized adaptations in its NADH-quinone oxidoreductase complex .

  • Flavin-based electron bifurcation (FBEB): Proteomic studies have revealed that D. reducens expresses proteins homologous to FBEB pathways under specific conditions, suggesting potential integration with the NADH-quinone oxidoreductase system. These include heterodisulfide reductase (hdr)-containing loci that are upregulated during either sulfate reduction (Dred_0633-4, Dred_0689-90, and Dred_1325-30) or Fe(III)-citrate reduction (Dred_0432-3 and Dred_1778-84) .

  • Terminal electron transfer: While conventional NADH-quinone oxidoreductase complexes transfer electrons from iron–sulfur cluster N2 to quinone, D. reducens may employ additional or alternative mechanisms given its metal-reducing capabilities .

The nuoA subunit likely supports these specialized electron transfer pathways, potentially through unique structural adaptations or interaction partners not present in model organisms.

What inhibitors are effective for studying D. reducens NADH-quinone oxidoreductase function?

Several inhibitors have demonstrated effectiveness in studying NADH-quinone oxidoreductase function:

InhibitorTarget siteEffective concentration rangeApplication
RotenoneQuinone binding site1-10 μMCompetitive inhibition studies
Piericidin APSST/NQO6 subunit0.1-1 μMHigh-affinity site blocking
Diphenyleneiodonium (DPI)Flavoproteins and heme-containing proteins5-50 μMGeneral flavoprotein inhibition
BullatacinTerminal electron transfer0.5-5 μMSpecific complex I inhibition
PyridabenPSST subunit binding0.1-1 μMPhotoaffinity labeling studies

Research indicates that the PSST subunit (equivalent to bacterial NQO6) contains a conserved inhibitor-binding site that plays a key role in electron transfer by functionally coupling iron–sulfur cluster N2 to quinone . Photoaffinity labeling studies using [(trifluoromethyl)diazirinyl[3H]pyridaben ([3H]TDP) have successfully identified this binding site in both mitochondrial and bacterial systems . These inhibitors can be valuable tools for characterizing the D. reducens complex, though specific sensitivities may vary.

How can the quinone binding characteristics of D. reducens NADH-quinone oxidoreductase be measured?

Several methodological approaches can be employed to characterize quinone binding:

  • Direct binding assays:

    • Isothermal titration calorimetry (ITC) to determine binding constants

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Fluorescence quenching using intrinsic tryptophan fluorescence

  • Enzymatic activity measurements:

    • Spectrophotometric monitoring of NADH oxidation rates

    • Oxygen consumption measurements using various quinone analogs

    • Coupled enzyme assays tracking electron transfer to final acceptors

  • Structural studies:

    • Saturation transfer difference NMR to map quinone binding sites

    • Photoaffinity labeling with quinone analogs like [3H]TDP

    • Competition assays with known inhibitors

Studies have demonstrated that some NADH-quinone oxidoreductases can bind two quinone analog ligands simultaneously with similar interaction constants, potentially enhancing catalytic efficiency . Such double occupancy might also occur in D. reducens and should be investigated using techniques like interligand Overhauser effects between quinone analogs .

How does D. reducens nuoA expression change under different electron acceptor conditions?

Proteomic analyses of D. reducens cultivated under different conditions reveal distinct protein expression patterns specific to electron acceptor availability:

Growth conditionProtein expression patternPotential nuoA-related changes
Sulfate reductionUpregulation of hdr-containing loci (Dred_0633-4, Dred_0689-90, Dred_1325-30)May coordinate with specialized sulfate-reducing electron transport chains
Soluble Fe(III) reductionUpregulation of different hdr-containing loci (Dred_0432-3, Dred_1778-84)Likely involved in Fe(III)-specific electron transport pathways
Insoluble Fe(III) reductionDistinct protein expression signature from soluble Fe(III)May require additional membrane components for direct electron transfer
Pyruvate fermentationDifferent metabolic enzyme profilePotentially reduced expression of respiratory chain components

While the specific expression profile of nuoA was not directly reported in the available proteomic studies, its expression likely correlates with these broader metabolic shifts, particularly given the central role of NADH-quinone oxidoreductase in respiratory metabolism . Advanced researchers should consider performing targeted transcriptomic or proteomic analyses focusing specifically on nuoA expression across these conditions.

What methods are most effective for studying the interaction between D. reducens nuoA and other respiratory complex subunits?

Several complementary approaches can effectively characterize subunit interactions:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with subunit-specific antibodies

    • Bacterial two-hybrid assays for direct interaction testing

    • Cross-linking mass spectrometry to map interaction interfaces

    • FRET-based approaches using fluorescently tagged subunits

  • Structural biology approaches:

    • Cryo-electron microscopy of the intact complex

    • X-ray crystallography of sub-complexes

    • NMR studies of isolated domains

    • Molecular dynamics simulations based on homology models

  • Functional assays:

    • Complementation studies with chimeric subunits

    • Site-directed mutagenesis of predicted interaction residues

    • Activity assays of reconstituted sub-complexes

Studies on related organisms reveal that NADH-quinone oxidoreductase subunits work together in specific arrangements, with particular relevance to the terminal electron transfer step from iron–sulfur cluster N2 to quinone . The interaction of nuoA with other subunits likely defines its role in proton translocation and structural integrity of the membrane domain.

How can researchers investigate the potential involvement of D. reducens NADH-quinone oxidoreductase in flavin-based electron bifurcation?

Investigating the connection between NADH-quinone oxidoreductase and flavin-based electron bifurcation (FBEB) requires specialized approaches:

  • Gene expression correlation analysis:

    • RNA-seq to identify co-regulated gene clusters

    • ChIP-seq to identify common regulatory elements

    • Comparison of expression patterns across growth conditions

  • Protein complex analysis:

    • Blue native PAGE to isolate intact complexes

    • Sucrose gradient ultracentrifugation to separate complexes

    • Mass spectrometry of isolated complexes to identify components

  • Electron flow tracing:

    • Isotope labeling to track electron donors and acceptors

    • Spectroscopic monitoring of flavin and iron-sulfur cluster reduction states

    • Thermodynamic measurements of electron bifurcation reactions

The proteomic data indicating upregulation of hdr-containing loci under specific growth conditions suggests potential integration of FBEB with conventional electron transport chains in D. reducens . Two identified loci (Dred_1325-30 and Dred_1778-84) show homology to described FBEB pathways and warrant detailed investigation regarding their functional relationship with NADH-quinone oxidoreductase components .

How does D. reducens nuoA compare structurally and functionally to equivalent subunits in other bacteria?

A comparative analysis reveals important evolutionary patterns:

OrganismNADH-quinone oxidoreductase characteristicsnuoA/homolog features
D. reducens (Gram+)Metal-reducing capability, multiple electron acceptorsLikely specialized for diverse respiratory conditions
P. denitrificans (Gram-)14 subunits in NDH-1NQO6 homologous to mitochondrial PSST with conserved inhibitor binding site
T. thermophilus (Gram-)14 subunits, thermostable propertiesNQO6 structure determined, provides model for homology studies
E. coli (Gram-)Well-characterized model systemnuoA structure and function extensively studied
Mitochondrial Complex I>40 subunits, highly evolved systemPSST subunit critical for terminal electron transfer step

The structural divergence of D. reducens nuoA from Gram-negative counterparts likely reflects adaptation to both the Gram-positive cell envelope and its metabolic versatility . LpdG, a flavoprotein encoded by dihydrolipoamide dehydrogenase, represents a potential connecting point between conventional NADH oxidation and alternative electron transfer pathways in related systems . Crystal structures of LpdG from related organisms have been resolved in various states (apo-form at 1.35 Å, NAD+-bound at 1.45 Å, and NADH-bound at 1.79 Å), providing templates for structural modeling of D. reducens components .

What experimental approaches can detect post-translational modifications of D. reducens nuoA?

Post-translational modifications (PTMs) can significantly impact protein function:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics to identify modification sites

    • Top-down proteomics to characterize intact proteoforms

    • Targeted multiple reaction monitoring for specific modifications

    • Enrichment strategies for phosphorylation, acetylation, or redox-sensitive modifications

  • Antibody-based detection:

    • Western blotting with PTM-specific antibodies

    • Immunoprecipitation followed by MS analysis

    • Immunofluorescence microscopy for cellular localization of modified forms

  • Activity correlation:

    • Site-directed mutagenesis of potential modification sites

    • Activity assays under conditions promoting/inhibiting modifications

    • In vitro modification assays with purified enzymes

In related bacterial systems, NADH-quinone oxidoreductase components undergo various modifications including phosphorylation, acetylation, and redox-sensitive cysteine modifications that can alter activity in response to metabolic conditions . The presence of multiple cysteine residues in related subunits suggests potential for redox regulation, particularly relevant in D. reducens given its growth across aerobic and anaerobic conditions.

How might recombinant D. reducens nuoA be utilized for bioremediation applications?

The unique characteristics of D. reducens NADH-quinone oxidoreductase components present several opportunities for bioremediation:

  • Metal reduction applications:

    • Engineering enhanced metal reduction capabilities for uranium, chromium, and other contaminants

    • Developing biosensors based on electron transfer activity

    • Creating immobilized enzyme systems for continuous treatment processes

  • Bioenergy applications:

    • Integration with microbial fuel cells for electricity generation

    • Coupling to bioproduction pathways for value-added compounds

    • Engineering electron transfer to artificial acceptors

  • Environmental monitoring:

    • Developing reporter systems based on D. reducens respiratory activity

    • Creating biosensors for specific metal species

    • Monitoring bioremediation progress in field applications

The metal-reducing capabilities of D. reducens make its electron transport components particularly valuable for bioremediation applications . While direct evidence for nuoA's specific role is limited, its position within the respiratory chain suggests it could be a key target for engineering enhanced electron transfer to challenging substrates like insoluble Fe(III) oxides or other metal contaminants.

What research gaps remain in understanding the structure-function relationship of D. reducens nuoA?

Despite advances in understanding NADH-quinone oxidoreductase, several research gaps remain:

  • Structural characterization:

    • High-resolution structure determination of D. reducens nuoA

    • Mapping of interaction surfaces with other subunits

    • Conformational changes during the catalytic cycle

  • Functional specialization:

    • Role in adaptation to diverse electron acceptors

    • Contribution to proton translocation

    • Integration with alternative electron transfer pathways

  • Regulatory mechanisms:

    • Transcriptional regulation under different growth conditions

    • Post-translational modifications affecting activity

    • Assembly and degradation processes

  • Evolutionary aspects:

    • Adaptation to Gram-positive bacterial physiology

    • Comparison with homologs in closely related species

    • Horizontal gene transfer events shaping complex composition

Future researchers should consider combining structural biology approaches with in vivo functional studies to bridge these knowledge gaps. The recent advances in cryo-electron microscopy make structural determination of membrane protein complexes increasingly feasible, while CRISPR-based genome editing allows precise functional testing in native contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.