Recombinant Desulfotomaculum reducens UPF0059 membrane protein Dred_3165 (Dred_3165)

What is Desulfotomaculum reducens UPF0059 membrane protein Dred_3165 and what is its biological significance?

Dred_3165, also known as MntP, is a putative manganese efflux pump protein encoded in the genome of Desulfotomaculum reducens, a Gram-positive sulfate- and metal-reducing bacterium. The protein consists of 180 amino acids with the sequence: MSLFTLFALAVALGTDAFSLCIGIGIAGVNRRQIALISLTVLIFHILMPLLGWYAGGFLGSKMGQAASIAGALLLLYLGGKMIWDTIKPGKDEGPRFVITNTGGLLLLSASVSMDALSVGFTLGTQQVSLVLAAGVIGLVAGMMTFAGLTLGKYVGDWIGERAELVGGIILVGIGVKLFF .

As a membrane protein classified in the UPF0059 family, Dred_3165 is believed to play significant roles in metal homeostasis, particularly in manganese efflux. This protein gains importance in understanding how D. reducens maintains metal ion balance, which is crucial for its survival in metal-rich environments. Its study provides insights into bacterial responses to environmental stressors, particularly heavy metals, and contributes to our understanding of microbial adaptation mechanisms .

How does Dred_3165 function in relation to D. reducens' metal reduction capabilities?

Dred_3165, as a putative manganese efflux pump, functions as part of D. reducens' sophisticated metal homeostasis system. Research on D. reducens' response to uranium exposure indicates that metal homeostasis genes, including those potentially regulating Dred_3165 expression, are upregulated during exposure to heavy metals, suggesting a coordinated response to maintain cellular metal balance .

While the exact mechanism remains under investigation, the protein likely contributes to metal reduction capabilities indirectly by:

The transcriptomic analysis of D. reducens during uranium exposure revealed upregulation of genes involved in respiration, such as NADH quinone oxidoreductase and heterodisulfide reductase, suggesting that electrons are shuttled to the electron transport chain during fermentation in the presence of metals like uranium . This process may involve membrane proteins like Dred_3165 as part of the coordinated cellular response to metal exposure.

What are the recommended protocols for expressing and purifying recombinant Dred_3165?

Based on established protocols for recombinant Dred_3165 expression and purification, researchers should follow these methodological steps:

Expression System and Conditions:

• Use E. coli as the expression host system for recombinant production

• Clone the full-length Dred_3165 gene (encoding amino acids 1-180) into an appropriate expression vector with an N-terminal His-tag

• Transform the construct into competent E. coli cells

• Induce expression using optimal conditions (temperature, inducer concentration, and duration should be optimized)

Purification Protocol:

• Harvest cells and lyse using appropriate buffer systems

• Clarify lysate by centrifugation

• Perform immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

• Consider additional purification steps such as size exclusion chromatography if higher purity is required

• Lyophilize the purified protein for long-term storage

Storage Recommendations:

• Store lyophilized protein at -20°C/-80°C

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

• Aliquot and store at -20°C/-80°C

• Avoid repeated freeze-thaw cycles

• For working aliquots, store at 4°C for up to one week

How can researchers effectively differentiate between active and inactive forms of Dred_3165 in experimental settings?

Differentiating between active and inactive forms of Dred_3165 requires multiple complementary approaches:

Functional Assays:

• Manganese Transport Assays: Measure manganese efflux in membrane vesicles or reconstituted proteoliposomes containing purified Dred_3165

• Metal Sensitivity Tests: Compare growth of cells expressing wild-type versus mutant Dred_3165 under varying manganese concentrations

• Radioactive Metal Uptake/Efflux: Use isotopically labeled manganese to quantify transport activity

Structural Integrity Assessment:

• Circular Dichroism (CD) Spectroscopy: Compare spectral profiles of putative active and inactive forms to detect secondary structure differences

• Limited Proteolysis: Active proteins often have different proteolytic digestion patterns compared to inactive forms

• Thermal Shift Assays: Measure protein thermal stability, which often correlates with functional state

Activity Correlation Table:

When interpreting results, researchers should consider that metal transport proteins like Dred_3165 often require proper membrane insertion and specific lipid environments for full activity.

What techniques are most effective for studying Dred_3165 interactions with metal ions?

Several complementary techniques provide robust data for studying Dred_3165 interactions with metal ions:

Direct Binding Assays:

• Isothermal Titration Calorimetry (ITC): Measures thermodynamic parameters of metal binding to purified Dred_3165

• Microscale Thermophoresis (MST): Detects subtle changes in protein movement upon metal binding

• Surface Plasmon Resonance (SPR): Provides real-time binding kinetics with immobilized protein

Spectroscopic Methods:

• Fluorescence Spectroscopy: Monitor intrinsic tryptophan fluorescence changes upon metal binding

• Circular Dichroism (CD): Detect secondary structure changes induced by metal binding

• X-ray Absorption Spectroscopy (XAS): Determine coordination environment of bound metals

Functional Approaches:

• Metal Transport Assays: Use radioisotopes or fluorescent metal indicators in reconstituted systems

• Competition Assays: Test specificity by competing different metals for binding/transport

• Mutagenesis Studies: Identify critical residues for metal coordination and transport

Data Integration Approach:

How does the transcriptional regulation of Dred_3165 change under various metal stress conditions?

The transcriptional regulation of Dred_3165 under metal stress conditions exhibits complex patterns that inform our understanding of D. reducens' metal adaptation mechanisms. Based on studies of D. reducens' response to uranium exposure, we can infer similar regulatory patterns for Dred_3165 under various metal stresses .

Transcriptional Response Patterns:

Research on D. reducens has shown that genes involved in metal homeostasis are differentially regulated during metal exposure. During uranium exposure, for instance, genes involved in iron homeostasis were upregulated, consistent with the upregulation of genes involved in c-type cytochrome biogenesis . While specific data for Dred_3165 transcriptional regulation under various metal conditions is not fully characterized in the available literature, we can propose the following methodological approach to study this phenomenon:

• RNA-Seq Analysis: Perform transcriptome profiling of D. reducens under exposure to different metals (Mn, Fe, U, etc.) at various concentrations and time points

• qRT-PCR Validation: Confirm expression changes of Dred_3165 and related genes under selected conditions

• Promoter Analysis: Identify metal-responsive elements in the Dred_3165 promoter region

• Chromatin Immunoprecipitation (ChIP): Identify transcription factors binding to the Dred_3165 promoter under different metal stress conditions

Temporal Expression Patterns:

Based on uranium exposure studies, the transcriptional response likely follows time-dependent patterns. Analysis of time-dependent gene expression showed that sporulation was the dominant process at the early stationary phase, and the presence of uranium at that stage did not significantly impact expression . This suggests that metal stress responses are growth phase-dependent, requiring time-course studies to fully characterize Dred_3165 regulation.

Integrated Regulatory Network:

Dred_3165 regulation should be studied within the context of the broader metal homeostasis network, including potential cross-talk with other metal efflux systems and stress response pathways.

What role does Dred_3165 play in D. reducens' uranium reduction pathway compared to other metal reduction mechanisms?

The role of Dred_3165 in D. reducens' uranium reduction pathway presents an intriguing research question that connects membrane protein function with metal reduction capabilities. While direct evidence specifically linking Dred_3165 to uranium reduction is limited in the available literature, we can analyze its potential role based on known metal reduction mechanisms in D. reducens.

Comparative Analysis of Metal Reduction Pathways:

Studies on D. reducens' transcriptomic response to uranium exposure revealed that genes encoding for proteins involved in respiration, such as NADH quinone oxidoreductase and heterodisulfide reductase, were upregulated during fermentative growth in the presence of U(VI) . This suggests that electrons are shuttled to the electron transport chain during fermentation and points to the reduction of U(VI) as a metabolic process.

The relationship between Dred_3165 (a putative manganese efflux pump) and uranium reduction could involve:

• Metal Homeostasis Coordination: Maintaining proper intracellular metal concentrations to support optimal function of enzymes involved in uranium reduction

• Indirect Electron Transfer Support: Facilitating the activity of electron transport chain components that ultimately contribute to uranium reduction

• Metal Specificity Regulation: Potentially participating in discrimination between different metals within the cell

Uranium Reduction Characteristics:

A notable observation from uranium reduction studies with D. reducens is that U(IV) produced during active growth was not retained by a 0.2 μm pore size filter, indicating that filtration was insufficient to differentiate between U(VI) and U(IV) . This unusual solubility characteristic of biologically produced U(IV) raises questions about the cellular localization of uranium reduction and the potential involvement of membrane proteins like Dred_3165.

Experimental Approach to Determine Dred_3165's Role:

Researchers investigating this question should consider using a combination of genetic manipulation, protein localization studies, and metal reduction assays to establish the functional relationship between Dred_3165 and uranium reduction pathways.

How do post-translational modifications affect Dred_3165 function in metal homeostasis?

Post-translational modifications (PTMs) likely play crucial roles in regulating Dred_3165 function in metal homeostasis, though specific data on Dred_3165 PTMs is not explicitly detailed in the available literature. Based on knowledge of membrane protein regulation and metal transport systems, we can outline a methodological framework for investigating this question:

Potential PTMs Affecting Dred_3165 Function:

• Phosphorylation: May regulate transport activity through conformational changes

• Oxidation/Reduction: Could respond to redox conditions affecting metal binding

• Proteolytic Processing: Might activate or inactivate the protein under specific conditions

• Metal-Induced Conformational Changes: Direct interaction with metals may cause functional modifications

Methodological Approaches for PTM Identification:

• Mass Spectrometry-Based Proteomics:

  • Perform LC-MS/MS analysis of purified Dred_3165 under different metal exposure conditions

  • Use enrichment techniques specific for phosphopeptides, oxidized peptides, etc.

  • Compare PTM profiles between active and inactive states

• Site-Directed Mutagenesis:

  • Identify putative modification sites through sequence analysis and conservation patterns

  • Generate mutants mimicking or preventing specific modifications (e.g., phosphomimetic mutations)

  • Assess functional consequences through transport assays

• Real-Time PTM Monitoring:

  • Develop fluorescent reporters or FRET-based systems to monitor conformational changes

  • Use metal-sensitive probes to correlate metal binding with structural modifications

PTM Function Correlation Framework:

By systematically characterizing PTMs and correlating them with functional states, researchers can develop a mechanistic understanding of how Dred_3165 activity is regulated in response to changing metal concentrations and environmental conditions.

How can Dred_3165 be leveraged in engineered systems for heavy metal bioremediation?

Leveraging Dred_3165 in engineered systems for heavy metal bioremediation represents an innovative application of this membrane protein's metal transport capabilities. While direct evidence for Dred_3165 in bioremediation applications is not explicitly detailed in the available literature, we can propose methodological approaches based on the protein's putative function as a manganese efflux pump and D. reducens' known metal reduction capabilities .

Bioremediation System Design Approaches:

• Whole-Cell Bioremediation Systems:

  • Engineer D. reducens strains with optimized Dred_3165 expression

  • Design immobilization matrices compatible with D. reducens growth

  • Develop bioreactor configurations optimized for metal contact and reduction

• Cell-Free Enzymatic Systems:

  • Reconstitute purified Dred_3165 in artificial membrane systems

  • Couple with electron donors and mediators to facilitate metal transformation

  • Immobilize on support materials for enhanced stability and reusability

• Genetic Engineering for Enhanced Function:

  • Create Dred_3165 variants with broader metal specificity

  • Optimize expression systems for industrial-scale protein production

  • Develop fusion proteins combining Dred_3165 with other metal-binding domains

Performance Metrics for Bioremediation Systems:

Integration with Existing Technologies:

For practical applications, Dred_3165-based systems should be developed as complementary technologies to existing treatment methods, potentially serving as:

• Pre-treatment systems for reducing metal bioavailability

• Polishing steps for removing metals at low concentrations

• Specialized treatments for difficult-to-remove metal species

Researchers should focus on addressing challenges such as system stability, metal specificity, and process economics when developing Dred_3165-based bioremediation technologies.

What insights does comparative analysis of Dred_3165 with similar proteins from other metal-reducing bacteria provide?

Comparative analysis of Dred_3165 with similar proteins from other metal-reducing bacteria offers valuable insights into evolutionary adaptations and functional conservation across different microbial systems. While direct comparative data specifically for Dred_3165 is limited in the available literature, we can outline a methodological framework for such analysis:

Phylogenetic Analysis and Evolutionary Insights:

Researchers should conduct comprehensive phylogenetic analysis of UPF0059 family proteins and putative manganese efflux pumps across diverse bacterial species, with particular focus on:

• Sequence conservation patterns in metal-binding regions

• Evolutionary relationships between metal transporters in Gram-positive vs. Gram-negative bacteria

• Adaptive evolution signatures in species from metal-rich environments

Structural Comparison Approaches:

• Homology Modeling: Generate structural models of Dred_3165 and homologous proteins

• Conservation Mapping: Identify conserved residues likely critical for function

• Molecular Dynamics Simulations: Compare dynamics and metal interaction mechanisms

Functional Comparison Framework:

Experimental Validation Strategy:

To validate comparative insights, researchers should:

• Express selected homologs in a common host system

• Compare metal transport capabilities under identical conditions

• Perform domain-swapping experiments to identify functional regions

• Test complementation ability in knockout strains

This comparative approach would reveal whether Dred_3165's function in metal homeostasis represents a conserved mechanism across metal-reducing bacteria or a specialized adaptation specific to D. reducens' ecological niche.

How does Dred_3165 expression and function change in biofilm versus planktonic growth states?

The differential expression and function of Dred_3165 in biofilm versus planktonic growth states represents an important but understudied aspect of this protein's role in D. reducens' physiology. While specific data on Dred_3165 in biofilms is not explicitly detailed in the available literature, we can outline a methodological framework for investigating this question based on knowledge of bacterial biofilms and metal homeostasis:

Expression Analysis Methodology:

• Transcriptomic Comparison:

  • Perform RNA-Seq analysis comparing biofilm and planktonic cells

  • Use qRT-PCR to specifically quantify Dred_3165 expression levels

  • Analyze expression patterns at different biofilm development stages

• Protein Localization Studies:

  • Develop fluorescent protein fusions to track Dred_3165 localization

  • Use immunofluorescence microscopy with anti-Dred_3165 antibodies

  • Compare subcellular distribution patterns between growth states

Functional Analysis Approaches:

• Metal Distribution Analysis:

  • Use synchrotron-based X-ray fluorescence microscopy to map metal distributions

  • Compare intracellular manganese concentrations between biofilm and planktonic cells

  • Analyze metal profiles in biofilm extracellular polymeric substances (EPS)

• Genetic Manipulation Studies:

  • Assess phenotypes of Dred_3165 knockout strains in biofilm formation

  • Evaluate metal tolerance differences between growth states

  • Test complementation with controlled expression systems

Biofilm-Specific Considerations:

Research Significance:

Understanding Dred_3165 function in biofilms has particular relevance for:

• Environmental bioremediation applications where biofilms are common

• Natural attenuation of contaminants in subsurface environments

• Development of biofilm-based treatment technologies

Researchers should design experiments that account for the inherent heterogeneity in biofilm systems, potentially using advanced imaging techniques and single-cell analyses to resolve spatial variations in expression and function.

What are the current technical challenges in studying integral membrane proteins like Dred_3165 and how can they be overcome?

Studying integral membrane proteins like Dred_3165 presents several technical challenges that require specialized approaches. Based on general membrane protein research difficulties and specific considerations for metal transporters, the following methodological strategies are recommended:

Expression and Purification Challenges:

• Low Expression Yields:

  • Challenge: Membrane protein overexpression often leads to toxicity and inclusion body formation

  • Solution: Use specialized expression systems (C41/C43 E. coli strains, cell-free systems) with controlled induction

  • Methodological approach: Screen multiple constructs with varying fusion tags and expression conditions

• Maintaining Structural Integrity:

  • Challenge: Membrane proteins often denature during extraction from membranes

  • Solution: Optimize detergent selection and concentration for extraction and purification

  • Methodological approach: Perform detergent screening using thermal stability assays to identify optimal conditions

Structural Analysis Limitations:

• Crystallization Difficulties:

  • Challenge: Membrane proteins are notoriously difficult to crystallize

  • Solution: Consider alternative structural methods like cryo-EM or NMR for smaller proteins

  • Methodological approach: Use lipidic cubic phase crystallization or antibody fragment co-crystallization

• Functional Reconstitution:

  • Challenge: Maintaining activity after purification

  • Solution: Reconstitute into liposomes or nanodiscs to provide native-like lipid environment

  • Methodological approach: Test multiple lipid compositions mimicking D. reducens membrane

Technology Advancement Opportunities:

By addressing these technical challenges, researchers can advance our understanding of Dred_3165 structure, function, and role in metal homeostasis, potentially leading to applications in bioremediation and biotechnology.

How might functional differences between recombinant and native Dred_3165 affect experimental interpretations?

Understanding the functional differences between recombinant and native Dred_3165 is critical for accurate experimental interpretation. While direct comparative data is limited in the available literature, the following methodological considerations should guide research:

Source of Potential Differences:

• Post-translational Modifications:

  • Native Dred_3165 may undergo PTMs absent in recombinant systems

  • E. coli expression systems may not replicate the PTM patterns of D. reducens

  • Systematic comparison of PTM profiles should be performed using mass spectrometry

• Protein Folding and Stability:

  • Differences in membrane composition between expression host and D. reducens

  • Temperature differences in optimal growth conditions

  • Expression rate effects on proper membrane insertion

• Fusion Tags and Construct Design:

  • The N-terminal His-tag used in recombinant expression may affect function

  • Potential interference with signal sequences or trafficking

  • Tag position (N- vs. C-terminal) may have different functional impacts

Methodological Approaches for Comparison:

• Activity Assays:

  • Compare metal transport rates between native membranes and reconstituted systems

  • Measure binding affinities for relevant metals

  • Assess oligomerization states and their functional significance

• Structural Integrity Assessment:

  • Compare thermal stability profiles

  • Assess detergent resistance and extraction properties

  • Analyze conformational flexibility using hydrogen-deuterium exchange

Experimental Design Considerations:

Impact on Data Interpretation:

Researchers should consider these potential differences when:

• Extrapolating in vitro findings to in vivo processes

• Developing structure-function relationships

• Designing inhibitors or modulators of function

• Engineering proteins for biotechnological applications

Where possible, validation of key findings should be performed in both recombinant and native systems to ensure biological relevance.

What emerging technologies might advance our understanding of Dred_3165's role in metal homeostasis and reduction?

Several emerging technologies hold promise for advancing our understanding of Dred_3165's role in metal homeostasis and reduction. By integrating these cutting-edge approaches, researchers can overcome current limitations and gain unprecedented insights:

Advanced Imaging Technologies:

• Cryo-Electron Tomography:

  • Application: Visualize Dred_3165 in its native membrane environment

  • Advantage: Preserves cellular context without fixation artifacts

  • Methodological approach: Correlate protein distribution with metal localization in intact cells

• Super-Resolution Microscopy:

  • Application: Track dynamic processes of metal transport in living cells

  • Advantage: Overcomes diffraction limit for nanoscale visualization

  • Methodological approach: Use fluorescent protein fusions or click chemistry labeling

Genetic and Molecular Technologies:

• CRISPR-Cas9 Genome Editing:

  • Application: Generate precise modifications to Dred_3165 in its native context

  • Advantage: Avoids overexpression artifacts, maintains natural regulation

  • Methodological approach: Create point mutations, domain swaps, or regulatable variants

• Single-Cell Transcriptomics/Proteomics:

  • Application: Capture cell-to-cell variation in Dred_3165 expression and function

  • Advantage: Reveals population heterogeneity masked in bulk analyses

  • Methodological approach: Correlate expression with metal reduction activity at single-cell level

Structural Biology Innovations:

• Time-Resolved Structural Methods:

  • Application: Capture dynamic conformational changes during transport cycle

  • Advantage: Reveals mechanistic details of transport process

  • Methodological approach: Use time-resolved cryo-EM or X-ray free electron laser techniques

• Integrative Structural Biology:

  • Application: Combine multiple data types for complete structural models

  • Advantage: Overcomes limitations of individual methods

  • Methodological approach: Integrate crystallography, cryo-EM, crosslinking MS, and molecular dynamics

Technology Integration Framework:

By strategically applying these emerging technologies, researchers can develop a comprehensive understanding of Dred_3165's role in metal homeostasis and reduction, potentially leading to novel applications in bioremediation and synthetic biology.