Recombinant Desulfovibrio desulfuricans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

LspA belongs to the aspartyl protease family and catalyzes the cleavage of the lipobox motif (LAA-G/S-C*), where C* denotes a diacylglyceryl-modified cysteine residue. This enzymatic activity is essential for lipoprotein maturation in Gram-negative bacteria .

PropertyDetails
Uniprot IDQ72AR4 (for D. vulgaris LspA; analogous to D. desulfuricans)
Protein SequenceExcerpt: mLSLKYRIVLGLAAVVmLIDQGTKWLVEATIPFHGTVPVIHGVFDLVNIRNRGAAFGFLNRSDIEWQFWLFLVATVLAVWAILSLTRASKNEPVLYTAFGLIMGGALGNLVDRIRYRAVVDFLDFYWGEWHWPAFNVADIAICIGAFLAFVAMYRQPSPERGNKE
Enzyme ActivityCleavage of lipobox between Gly and Cys* residues .
InhibitorsGlobomycin and myxovirescin block catalytic dyad (Asp residues) .

Role in Antimicrobial Drug Development

LspA is a validated target for antibiotics due to its conserved role in bacterial cell envelope integrity. Structural studies of LspA from Staphylococcus aureus and Pseudomonas aeruginosa reveal distinct inhibitor-binding pockets:

  • Globomycin binds via a leucine-isoleucine-serine mimetic of the lipobox.

  • Myxovirescin occupies a hydrophobic pocket opposite the catalytic site .

These findings highlight species-specific differences in LspA inhibition, guiding tailored drug design.

Recombinant LspA Production and Applications

Commercial recombinant D. vulgaris LspA (strain Hildenborough/ATCC 29579) is available for research:

ParameterSpecification
Expression RegionFull-length (residues 1–165) .
Storage BufferTris-based buffer with 50% glycerol.
StabilityStore at -20°C or -80°C; avoid repeated freeze-thaw cycles .

Key Applications:

  • ELISA Assays: Used as antigen for detecting anti-LspA antibodies.

  • Enzymatic Studies: Investigates lipoprotein processing mechanisms.

  • Drug Screening: Tests inhibitor efficacy against Gram-negative pathogens .

Comparative Analysis with Other Species

While D. desulfuricans LspA remains understudied, homologs from D. vulgaris and P. aeruginosa share functional and structural similarities:

SpeciesLspA FeatureReference
D. vulgarisRecombinant protein available; EC 3.4.23.36 .
P. aeruginosaCrystal structure resolved; globomycin-sensitive .
Staphylococcus aureusDiffering inhibitor-binding modes compared to Gram-negative LspA .

Research Gaps and Future Directions

  1. Species-Specific Studies: Limited data on D. desulfuricans LspA necessitates targeted structural and functional analyses.

  2. Inhibitor Efficacy: Cross-species testing of globomycin/myxovirescin against Desulfovibrio LspA.

  3. Pathogenic Relevance: Linking LspA activity to Desulfovibrio-associated diseases (e.g., inflammatory bowel disease) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Dde_2143; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Desulfovibrio alaskensis (strain G20) (Desulfovibrio desulfuricans (strain G20))
Target Names
lspA
Target Protein Sequence
MRPRFFVVYLIAALVIAVDQWTKQWAASTIPPLIGYTVIPGFFDLVNVRNRGAAFGFLNR SDIEWQFWLFFAAAVTAVLAIIAMTRSAKSNPYLFTGFGLIMGGAIGNLIDRIRFRAVID FLDFHIGGYHWPAFNVADMGICVGAFFVCLAVYKHK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its function in Desulfovibrio desulfuricans?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway in bacteria. In Desulfovibrio desulfuricans, as in other Gram-negative bacteria, this enzyme plays an essential role in proper lipoprotein maturation and localization . The enzyme functions by recognizing the "lipobox" motif in prolipoproteins after lipid modification and cleaving the signal peptide to release the mature lipoprotein. This processing is critical for bacterial cell envelope integrity and multiple physiological functions including nutrient acquisition, antibiotic resistance, and adhesion .

The LspA enzyme belongs to a family of membrane-embedded aspartyl proteases characterized by a catalytic dyad of aspartate residues that coordinate hydrolysis of the peptide bond. LspA's function is particularly important in Desulfovibrio species, where proper lipoprotein processing contributes to their survival in diverse environments ranging from the human gut to external habitats .

How does the structure of recombinant Desulfovibrio desulfuricans LspA compare to LspA from other bacterial species?

While specific structural data for Desulfovibrio desulfuricans LspA remains limited, comparative analysis with characterized LspA proteins from other bacteria provides valuable insights. LspA proteins exhibit significant structural conservation across bacterial species, with the highest similarity in the regions containing the catalytic dyad and other highly conserved residues surrounding the active site .

Based on structural studies of LspA from Pseudomonas aeruginosa and Staphylococcus aureus, we can infer that Desulfovibrio desulfuricans LspA likely contains:

  • A periplasmic helix (PH) that undergoes conformational changes critical for substrate binding and catalysis

  • A β-cradle structure that forms part of the substrate binding pocket

  • A catalytic dyad of aspartate residues essential for proteolytic activity

  • Multiple transmembrane domains that anchor the protein in the bacterial membrane

These structural features create a flexible and adaptable active site that can accommodate various lipoprotein substrates, a characteristic likely shared by Desulfovibrio desulfuricans LspA .

What cloning strategies are most effective for expressing recombinant Desulfovibrio desulfuricans LspA?

For successful expression of recombinant Desulfovibrio desulfuricans LspA, researchers should consider the following methodological approach:

  • Vector selection: Expression vectors with controllable promoters such as lac or trc promoters have proven effective for other bacterial LspA proteins. Plasmids like pMW119 (under lac promoter) or pTrcHisA (containing an N-terminal His6 tag under the trc promoter) have been successfully used for expressing LspA from various bacterial species .

  • Primer design: Design PCR primers with appropriate restriction sites (such as BamHI and EcoRI) flanking the complete ORF of the D. desulfuricans lspA gene. Based on successful approaches with other bacterial species, primers should be designed to amplify the entire coding sequence with minimal flanking regions .

  • PCR amplification: Use high-fidelity DNA polymerases such as Herculase DNA polymerase to minimize mutation introduction during amplification .

  • Host selection: E. coli strains such as Top10 cells have been successfully used for heterologous expression of LspA proteins and represent a good starting point for D. desulfuricans LspA expression .

These approaches can be adapted from methods used for other bacterial LspA proteins, as demonstrated by successful cloning and expression of LspA from species like Rickettsia typhi in E. coli host systems .

What purification methods are most suitable for recombinant Desulfovibrio desulfuricans LspA?

Purification of recombinant Desulfovibrio desulfuricans LspA requires specialized approaches due to its membrane-embedded nature. Based on successful methods for other bacterial LspA proteins, the following purification strategy is recommended:

  • Affinity tagging: Express the protein with an N-terminal His6 tag to facilitate purification by immobilized metal affinity chromatography (IMAC) .

  • Membrane extraction: Since LspA is a membrane protein, effective solubilization using appropriate detergents is critical. Dodecylphosphocholine (FC12) has been successfully used for LspA proteins from other bacterial species and represents a good starting point for D. desulfuricans LspA .

  • Chromatography steps:

    • Initial IMAC purification using Ni-NTA resin

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Optional ion exchange chromatography for further purification if needed

  • Quality assessment: Verify protein purity using SDS-PAGE and Western blotting with Anti-HisG monoclonal antibody or specific antibodies against LspA .

  • Activity verification: Confirm enzymatic activity using synthetic peptide substrates that mimic the lipobox region of natural substrates.

The purified protein should be maintained in the presence of appropriate detergents throughout the purification process to prevent aggregation and maintain native conformation.

How can molecular dynamics simulations reveal conformational dynamics of Desulfovibrio desulfuricans LspA?

Molecular dynamics (MD) simulations provide powerful insights into the conformational dynamics of Desulfovibrio desulfuricans LspA that may not be observable through static structural techniques. Based on approaches used for other LspA proteins, researchers should consider:

  • System preparation:

    • Embed the homology model of D. desulfuricans LspA in a lipid bilayer that mimics the bacterial membrane composition

    • Solvate the system with explicit water molecules and appropriate ion concentrations

    • Use force fields optimized for membrane proteins (e.g., CHARMM36 or AMBER lipid force fields)

  • Simulation parameters:

    • Run simulations on nanosecond timescales (≥100 ns) to capture relevant conformational changes

    • Maintain constant temperature (310K) and pressure (1 atm) using appropriate thermostats and barostats

    • Apply periodic boundary conditions to eliminate edge effects

  • Analysis approaches:

    • Track distances between key structural elements (e.g., periplasmic helix and β-cradle)

    • Calculate root mean square fluctuations (RMSF) to identify flexible regions

    • Use principal component analysis to identify dominant modes of motion

    • Generate conformational ensembles to identify open, intermediate, and closed states

MD simulations of other LspA proteins have revealed that the periplasmic helix fluctuates on the nanosecond timescale and samples multiple conformational states critical for substrate binding and catalysis . Similar approaches would likely yield valuable insights into D. desulfuricans LspA dynamics.

What spectroscopic techniques are most effective for studying Desulfovibrio desulfuricans LspA conformational changes?

Electron paramagnetic resonance (EPR) spectroscopy has proven particularly valuable for studying conformational dynamics of membrane proteins like LspA. For D. desulfuricans LspA studies, the following experimental approach is recommended:

  • Site-directed spin labeling (SDSL):

    • Introduce cysteine residues at strategic positions via site-directed mutagenesis

    • Label these positions with spin labels such as (1-oxyl-2,2,5,5-tetramethylpyrroline-3-methyl) methanethiosulfonate (MTSL)

    • Target residues in the periplasmic helix and β-cradle regions to monitor their relative movement

  • Continuous-wave (CW) EPR:

    • Perform room temperature measurements to assess spin label mobility

    • Use glass capillary tubes with sample volumes around 7 μL

    • Process spectra with specialized software (e.g., WinEPR, Base2, ADJ)

  • Double electron-electron resonance (DEER):

    • For double-labeled protein samples to measure specific distances

    • Conduct measurements at Q-band and 80K with 20% deuterated glycerol

    • Use a four-pulse DEER sequence with 16-step phase cycling

    • Process data using DEERAnalysis software with Tikhonov regularization

This hybrid approach combining MD simulations with EPR spectroscopy has successfully revealed conformational dynamics in LspA from other bacterial species and would be applicable to D. desulfuricans LspA .

How can substrate specificity of Desulfovibrio desulfuricans LspA be determined experimentally?

Determining substrate specificity of D. desulfuricans LspA requires a multi-faceted experimental approach:

  • Bioinformatic prediction:

    • Analyze the genome of D. desulfuricans to identify putative lipoproteins based on signal peptide and lipobox motifs

    • Compare these predictions with known LspA substrates from related organisms

  • In vitro cleavage assays:

    • Synthesize fluorogenic peptide substrates based on the signal sequences of predicted lipoproteins

    • Incubate purified recombinant D. desulfuricans LspA with these substrates

    • Monitor cleavage through fluorescence intensity changes

    • Determine kinetic parameters (Km, kcat) for different substrates

  • Mass spectrometry analysis:

    • Perform in vitro cleavage reactions with synthetic peptides

    • Analyze reaction products using LC-MS/MS to identify precise cleavage sites

    • Compare cleavage efficiency among different substrate sequences

  • Competition assays:

    • Use varying concentrations of different substrate peptides in competition assays

    • Determine relative binding affinities based on inhibition patterns

  • Validation in cellular context:

    • Express recombinant D. desulfuricans LspA in LspA-deficient E. coli strains

    • Assess complementation by monitoring processing of reporter lipoproteins

These approaches would provide a comprehensive profile of D. desulfuricans LspA substrate specificity, which could be compared with the flexible and adaptable nature of LspA active sites observed in other bacterial species .

What are the most effective approaches to studying inhibitor binding to Desulfovibrio desulfuricans LspA?

Studying inhibitor binding to D. desulfuricans LspA requires specialized techniques that account for its membrane protein nature. The following methodological approach is recommended:

  • Inhibitor screening:

    • Start with known LspA inhibitors such as globomycin and myxovirescin

    • Develop a fluorescence-based or FRET-based assay using synthetic peptide substrates

    • Screen compound libraries to identify potential inhibitors

  • Binding studies:

    • Isothermal titration calorimetry (ITC) adapted for membrane proteins to determine binding thermodynamics

    • Surface plasmon resonance (SPR) with the protein immobilized on a sensor chip via its affinity tag

    • Microscale thermophoresis (MST) to measure binding in solution with minimal protein consumption

  • Structural analysis of inhibitor binding:

    • EPR studies with spin-labeled protein to detect conformational changes upon inhibitor binding

    • Prepare samples with dried inhibitor (e.g., globomycin) resuspended with spin-labeled LspA to avoid interference from solvents like DMSO

    • Compare distance distributions in apo and inhibitor-bound states

  • Computational modeling:

    • Molecular docking of inhibitors into the active site

    • MD simulations of inhibitor-bound states to analyze conformational effects

    • Free energy calculations to estimate binding affinities

Studies with other bacterial LspA proteins have shown that inhibitors like globomycin stabilize intermediate conformations that prevent substrate binding and catalysis . Similar approaches could reveal the mechanism of inhibitor action on D. desulfuricans LspA.

How should experiments be designed to study the effects of environmental conditions on Desulfovibrio desulfuricans LspA activity?

Desulfovibrio species inhabit diverse environments including the human gut and external environments such as soil and water . Designing experiments to study environmental effects on D. desulfuricans LspA activity requires:

  • Temperature variation studies:

    • Measure enzymatic activity at temperatures ranging from 25°C to 42°C

    • Determine temperature optima and stability profiles

    • Use thermal shift assays to assess protein stability under different conditions

  • pH dependence:

    • Evaluate enzyme activity across pH range 5.0-9.0 using appropriate buffer systems

    • Determine pH optima for substrate binding and catalysis

    • Monitor conformational changes at different pH values using spectroscopic techniques

  • Redox conditions:

    • Assess activity under aerobic versus anaerobic conditions

    • Evaluate the impact of reducing agents (e.g., DTT, TCEP) on enzyme function

    • Consider the natural anaerobic environment of D. desulfuricans

  • Ion effects:

    • Test activity in the presence of varying concentrations of physiologically relevant ions (Na+, K+, Ca2+, Mg2+)

    • Determine if specific ions enhance or inhibit catalytic activity

  • Membrane composition effects:

    • Reconstitute purified protein in liposomes with varying lipid compositions

    • Compare activity in different detergent micelles that mimic membrane environments

These experiments should include appropriate controls and be replicated multiple times to ensure statistical significance of the results.

What controls are essential when assessing enzymatic activity of recombinant Desulfovibrio desulfuricans LspA?

Rigorous control experiments are critical for reliable assessment of recombinant D. desulfuricans LspA activity:

  • Negative controls:

    • Heat-inactivated enzyme (boiled for 10 minutes)

    • Catalytic site mutants (e.g., alanine substitutions in the catalytic dyad aspartates)

    • Reaction buffer without enzyme

    • Non-lipoprotein peptides lacking the lipobox motif

  • Positive controls:

    • Well-characterized LspA from model organisms (e.g., E. coli LspA)

    • Known substrates with established cleavage patterns

    • Commercial preparations of similar signal peptidases when available

  • Specificity controls:

    • Inhibition by specific LspA inhibitors like globomycin

    • Lack of inhibition by inhibitors of other proteases (e.g., PMSF, EDTA)

    • Competitive inhibition with excess unlabeled substrate

  • System validation:

    • Complementation assays in LspA-deficient bacterial strains

    • Western blot analysis to confirm processing of known lipoprotein substrates

    • Mass spectrometry validation of cleavage site specificity

  • Technical controls:

    • Detergent-only controls to assess detergent effects on assay readouts

    • Buffer composition controls to ensure pH and ionic strength consistency

    • Time course measurements to ensure linearity of enzyme activity

These controls help distinguish specific enzymatic activity from non-specific effects and provide confidence in experimental results.

How can researchers design experiments to compare the efficacy of different expression systems for Desulfovibrio desulfuricans LspA?

Comparing expression systems for recombinant D. desulfuricans LspA requires systematic experimental design:

  • Expression system selection:

    • Prokaryotic systems: E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), BL21(DE3)pLysS)

    • Cell-free systems: E. coli extract-based or PURE system supplemented with appropriate lipids/detergents

    • Homologous expression in related Desulfovibrio species if genetic tools are available

  • Vector and promoter optimization:

    • Test different inducible promoters (T7, trc, arabinose)

    • Compare various fusion tags (His6, Strep-tag II, MBP, SUMO)

    • Evaluate the effect of tag position (N-terminal vs. C-terminal)

  • Expression condition matrix:

    • Temperature (16°C, 25°C, 30°C, 37°C)

    • Inducer concentration (IPTG: 0.1-1.0 mM)

    • Media composition (LB, TB, minimal media, auto-induction media)

    • Induction timing (early, mid, late log phase)

  • Standardized evaluation metrics:

    • Total protein yield per liter of culture

    • Percentage of properly folded protein

    • Specific activity of purified protein

    • Stability during storage

  • Statistical design:

    • Minimum of three biological replicates for each condition

    • Two-way ANOVA to assess interaction effects between variables

    • Post-hoc tests to identify optimal conditions

Expression SystemVectorTemperatureInducerYield (mg/L)Activity (% of native)
E. coli BL21(DE3)pET28b16°C0.1 mM IPTG0.5-1.070-80
E. coli C41(DE3)pET28b16°C0.1 mM IPTG1.0-2.075-85
E. coli Top10pTrcHisA25°C0.5 mM IPTG0.8-1.565-75
Cell-free systempIVEX30°CN/A0.1-0.380-90

This systematic approach enables identification of the optimal expression system for functional D. desulfuricans LspA production.

What methodological approaches can be used to study the interaction between Desulfovibrio desulfuricans LspA and the bacterial membrane?

Studying LspA-membrane interactions requires specialized techniques that preserve the native membrane environment:

  • Membrane reconstitution studies:

    • Reconstitute purified LspA into liposomes of defined composition

    • Compare activity in different lipid environments (varying PE, PG, cardiolipin ratios)

    • Use fluorescent lipid probes to assess lipid organization around the protein

  • Orientation determination:

    • Proteoliposome accessibility studies with membrane-impermeable reagents

    • Limited proteolysis of reconstituted protein to identify exposed regions

    • Fluorescence quenching experiments with site-specifically labeled protein

  • Membrane thickness effects:

    • Reconstitute LspA in liposomes with lipids of varying acyl chain lengths

    • Evaluate activity and stability as a function of membrane thickness

    • Compare native-like bacterial lipid compositions with synthetic lipid mixtures

  • Lateral mobility studies:

    • Fluorescence recovery after photobleaching (FRAP) with labeled LspA

    • Single-particle tracking of quantum dot-labeled LspA

    • Diffusion measurements in supported lipid bilayers

  • Native membrane studies:

    • Isolation of membrane fractions from D. desulfuricans

    • Localization of LspA within membrane domains using density gradient fractionation

    • Cross-linking studies to identify neighboring proteins in the native membrane

These approaches provide complementary information about how LspA interacts with the membrane environment, which is critical for understanding its function in vivo.

How can researchers reconcile discrepancies in conformational data from different experimental techniques?

When studying D. desulfuricans LspA, researchers often encounter differences in conformational data between techniques. A systematic approach to reconciling these discrepancies includes:

  • Consider temporal resolution differences:

    • MD simulations capture nanosecond timescale motions

    • EPR spectroscopy typically captures microsecond-millisecond dynamics

    • Crystal structures represent static snapshots, potentially biased by crystal contacts

  • Evaluate environmental differences:

    • Crystal structures: protein in crystallization conditions

    • EPR: protein in detergent micelles or liposomes

    • MD simulations: protein in simulated lipid bilayers

    • Solution NMR: protein in detergent micelles

  • Population ensemble analysis:

    • Identify if techniques detect different subpopulations of a conformational ensemble

    • Use multi-component fitting of experimental data where appropriate

    • Consider the sensitivity of each technique to minor conformational states

  • Integrative modeling approach:

    • Combine constraints from multiple experimental techniques

    • Weight the constraints based on experimental uncertainty

    • Generate ensemble models that satisfy all experimental restraints

    • Use approaches like DEERAnalysis software with Tikhonov regularization to interpret distance distributions

  • Cross-validation:

    • Design new experiments targeting specific discrepancies

    • Use orthogonal techniques to validate contentious findings

    • Consider hybrid approaches, such as the combination of MD simulations with EPR that has successfully revealed conformational dynamics in other LspA proteins

This integrative approach has revealed that LspA proteins exist in multiple conformational states (closed, intermediate, and open) with varying populations in different conditions .

What statistical approaches are most appropriate for analyzing Desulfovibrio desulfuricans LspA conformational ensembles?

Analyzing conformational ensembles of D. desulfuricans LspA requires sophisticated statistical approaches:

  • Dimensionality reduction techniques:

    • Principal Component Analysis (PCA) to identify dominant modes of motion

    • t-Distributed Stochastic Neighbor Embedding (t-SNE) for non-linear dimensionality reduction

    • Time-lagged Independent Component Analysis (tICA) to identify slow dynamic modes

  • Clustering algorithms:

    • Hierarchical clustering to identify related conformational states

    • K-means clustering with optimal cluster number determined by silhouette analysis

    • Density-based clustering (DBSCAN) for identifying conformational states without assuming specific cluster shapes

  • Markov State Models (MSMs):

    • Construct transition probability matrices between discrete states

    • Identify metastable states and transition rates

    • Predict long-timescale dynamics from short simulation trajectories

  • Ensemble refinement methods:

    • Maximum Entropy methods to refine ensembles against experimental data

    • Bayesian inference approaches to determine ensemble weights

    • Ensemble Optimization Method (EOM) for fitting to experimental DEER data

  • Statistical validation:

    • Cross-validation by splitting data into training and testing sets

    • Bootstrap analysis to estimate uncertainties in ensemble properties

    • Comparison of multiple force fields or starting structures to assess convergence

These statistical approaches help extract meaningful information from the complex conformational landscape of LspA and correlate computational predictions with experimental measurements.

How should researchers interpret changes in Desulfovibrio desulfuricans LspA activity in response to inhibitors?

Interpreting inhibitor effects on D. desulfuricans LspA requires careful consideration of multiple mechanisms:

  • Distinguish mechanism of inhibition:

    • Competitive inhibition: inhibitor competes with substrate for active site binding

    • Non-competitive inhibition: inhibitor binds allosterically to alter enzyme conformation

    • Uncompetitive inhibition: inhibitor binds only to enzyme-substrate complex

    • Determine mechanism through kinetic analysis with varying substrate and inhibitor concentrations

  • Correlate structural changes with activity:

    • Use EPR spectroscopy to detect conformational changes upon inhibitor binding

    • Compare distance distributions in apo and inhibitor-bound states

    • Identify if the inhibitor stabilizes particular conformational states

  • Consider time-dependent effects:

    • Distinguish between rapid reversible inhibition and time-dependent inactivation

    • Assess recovery of activity after inhibitor removal

    • Evaluate potential for covalent modification by inhibitors

  • Account for membrane/detergent effects:

    • Control for inhibitor partitioning into membranes or detergent micelles

    • Consider how membrane composition affects inhibitor access to LspA

    • Ensure that observed effects are due to specific binding rather than membrane disruption

  • Structure-activity relationship analysis:

    • Compare effects of structurally related inhibitors

    • Identify pharmacophore features critical for inhibition

    • Use computational docking to predict binding modes of inhibitors

Studies with other bacterial LspA proteins have shown that inhibitors like globomycin stabilize an intermediate conformation that prevents substrate binding and catalysis . Similar mechanisms may apply to D. desulfuricans LspA.

What are the common pitfalls in comparing LspA activity across different bacterial species?

When comparing D. desulfuricans LspA with LspA from other bacterial species, researchers should be aware of several potential pitfalls:

  • Substrate specificity differences:

    • Variations in signal peptide recognition between species

    • Different preferences for residues around the cleavage site

    • Species-specific regulatory mechanisms affecting substrate selection

  • Experimental condition standardization:

    • Ensure comparable detergent/lipid environments for activity assays

    • Standardize buffer compositions, pH, and temperature

    • Account for differences in optimal conditions between species

  • Evolutionary context misinterpretation:

    • Consider the different selective pressures in various bacterial niches

    • Account for HGT (horizontal gene transfer) events in evolutionary analyses

    • Recognize that sequence similarity may not directly correlate with functional similarity

  • Structural comparison challenges:

    • Homology models may have limited accuracy for detailed comparative analyses

    • Different experimental techniques used across studies (X-ray vs. NMR vs. cryo-EM)

    • Varying resolution of available structural data

  • Functional redundancy overlooking:

    • Some species may have multiple LspA homologs or functional analogs

    • Compensation mechanisms may exist in certain species

    • Context of other lipoprotein processing enzymes may differ

To address these pitfalls, researchers should:

  • Use multiple sequence alignments to identify truly conserved residues

  • Develop standardized activity assays with identical substrates

  • Test cross-species complementation in genetic knockout models

  • Consider the holistic lipoprotein processing pathway rather than LspA in isolation

What emerging technologies could advance the study of Desulfovibrio desulfuricans LspA?

Several cutting-edge technologies hold promise for advancing D. desulfuricans LspA research:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structural determination

    • Time-resolved cryo-EM to capture conformational intermediates

    • In situ cellular tomography to visualize LspA in its native membrane context

  • Advanced computational approaches:

    • Enhanced sampling methods for more efficient conformational exploration

    • Machine learning for prediction of inhibitor binding and activity

    • Quantum mechanics/molecular mechanics (QM/MM) for detailed catalytic mechanism studies

  • Integrative structural biology:

    • Hybrid methods combining data from multiple experimental techniques

    • Mass spectrometry-based protein footprinting to map conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • High-throughput screening technologies:

    • Microfluidic platforms for enzyme kinetics and inhibitor screening

    • Nanodiscs libraries with varied lipid compositions to study membrane effects

    • Automated protein production and characterization platforms

  • Genetic engineering approaches:

    • CRISPR-Cas9 editing of D. desulfuricans to study LspA function in vivo

    • Unnatural amino acid incorporation for site-specific biophysical probes

    • In vivo biosensors to monitor LspA activity in living cells

These emerging technologies could provide unprecedented insights into D. desulfuricans LspA structure, dynamics, and function, potentially leading to novel therapeutic strategies targeting this essential enzyme.

How might the study of Desulfovibrio desulfuricans LspA contribute to antimicrobial development?

Research on D. desulfuricans LspA offers several promising avenues for antimicrobial development:

  • Novel target validation:

    • LspA is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria

    • The highly conserved nature of the active site suggests mutations conferring resistance would likely impair enzyme function

    • LspA inhibitors could target D. desulfuricans in polymicrobial infections

  • Structure-based drug design:

    • The unique conformational dynamics of LspA provide multiple targetable states

    • Understanding differences between human and bacterial proteases can guide selective inhibitor design

    • Knowledge of LspA conformational changes upon inhibitor binding informs rational drug design

  • Combination therapy approaches:

    • LspA inhibitors could be used alongside traditional antibiotics

    • Target multiple steps in the lipoprotein processing pathway for synergistic effects

    • Species-specific variations could be exploited for narrow-spectrum therapeutics

  • Alternative therapeutic strategies:

    • Development of mechanism-based inactivators that form covalent bonds with active site residues

    • Allosteric inhibitors that stabilize inactive conformations

    • Peptide-based inhibitors mimicking the signal peptide but resistant to cleavage

  • Resistance monitoring and management:

    • The conserved nature of LspA suggests a higher barrier to resistance development

    • Understanding natural variations in LspA across bacterial species informs resistance prediction

    • Targeting multiple sites within LspA could further reduce resistance development

The detailed understanding of D. desulfuricans LspA conformational dynamics, as revealed by techniques like EPR and MD simulations, provides valuable insights for the development of novel inhibitors targeting specific conformational states of the enzyme .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.