Recombinant Desulfovibrio desulfuricans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Ddes_1658; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)
Target Names
nuoK
Target Protein Sequence
MIPLSWYMALATVLFCIGVAGFLTRRNIIVMLLSLELMLNGVNLNLVAMSYFMDSLRGHV FTLFVITVAACEAAVGLGIVICLFRSRRTVRNDNIVELRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this particular species, the enzyme's immediate electron acceptor is believed to be ubiquinone. This process couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This mechanism conserves the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.