Recombinant Desulfovibrio desulfuricans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. Please specify your preferred tag type for prioritized development.

Synonyms
lgt; Dde_3768; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Desulfovibrio alaskensis (strain G20) (Desulfovibrio desulfuricans (strain G20))
Target Names
lgt
Target Protein Sequence
MIKYPAFDPVAFTLGPLNIRWYGLMYILGFVAAWLLARSRALKTGSGWTVEQVDDLVTYS VFGVILGGRLGYTLFYETSYFLNNPLDIFKIWNGGMSFHGGLLGVIIAIWLFARHTGKSL FEVGDFTAPLVAPGLLAGRLGNFINGELWGRHTSAEWGMVFPGAGPLPRHPSQLYEAALE GVALFIILWLFSAKPRPRMAVSGMFLLLYGSFRFFVEFFREPDLHLGYLAFGWVTMGQIL CLPMILGGLVLVGFAMKNEKQAALKTE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine residue of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Desulfovibrio species?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme involved in bacterial lipoprotein biosynthesis that catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to the sulfhydryl group of the cysteine in the lipoprotein signal sequence. In Desulfovibrio species, lgt plays an essential role in membrane integrity and protein sorting. The enzyme belongs to the EC 2.4.99.- class of glycosyltransferases that form glycosidic bonds . In Desulfovibrio vulgaris, lgt (Uniprot: Q72G45) is encoded by the DVU_0015 locus and comprises a 263-amino acid region expressing a full-length protein . While specific details for D. desulfuricans lgt are not as extensively documented, structural and functional conservation suggests similar properties between these closely related species.

How does lgt contribute to bacterial physiology in Desulfovibrio desulfuricans?

Lgt in Desulfovibrio desulfuricans facilitates the anchoring of lipoproteins to the bacterial membrane, which is crucial for multiple physiological processes. These lipoproteins participate in nutrient acquisition, cell signaling, and environmental adaptation, particularly in anaerobic sulfate-reducing conditions where D. desulfuricans typically thrives . The enzyme's function is especially important for maintaining membrane integrity under stressful environmental conditions. As D. desulfuricans has been implicated in colorectal cancer (CRC) chemoresistance mechanisms, the proper functioning of membrane proteins modified by lgt may contribute to the bacterium's ability to influence host metabolic pathways, including its reported capacity to elevate S-adenosylmethionine (SAM) levels, which has been linked to chemotherapy resistance in CRC patients .

What sequence homology exists between lgt proteins across Desulfovibrio species?

Sequence analysis reveals significant homology among lgt proteins in the Desulfovibrio genus. The Desulfovibrio vulgaris lgt protein, often used as a reference, contains conserved transmembrane domains and catalytic regions typical of this enzyme family . Comparison of lgt sequences from D. vulgaris and D. desulfuricans demonstrates evolutionary conservation of key functional domains, reflecting their shared ancestral origin. The G+C content of Desulfovibrio genes typically ranges from 55-60%, which is consistent with the observed G+C content of 60.3% in related genes from these organisms . This conservation suggests functional similarity, though species-specific variations may contribute to adaptation to different ecological niches.

How does recombinant expression affect the structure-function relationship of Desulfovibrio desulfuricans lgt?

Recombinant expression of Desulfovibrio desulfuricans lgt requires careful optimization to maintain proper folding and enzymatic activity. Expression in heterologous systems may affect post-translational modifications and membrane insertion patterns typical of native lgt. Studies with similar membrane-bound enzymes indicate that expression tags can influence both structure and function—N-terminal tags particularly may interfere with membrane insertion, while C-terminal modifications typically have less impact on enzyme activity. Researchers should consider that the hydrophobic nature of lgt's transmembrane domains often necessitates detergent solubilization during purification, which can alter conformational states compared to the native membrane environment . To assess functional integrity, enzyme activity assays comparing native and recombinant forms should measure diacylglyceryl transfer rates to model prolipoproteins under standardized conditions.

What is the potential role of lgt in Desulfovibrio-mediated chemoresistance in colorectal cancer?

Recent research has identified Desulfovibrio desulfuricans as a potential mediator of chemoresistance in colorectal cancer patients. Patients with higher intestinal abundance of Desulfovibrio showed poorer responses to FOLFOX chemotherapy (No Clinical Benefit responders) . While the direct role of lgt in this process remains to be fully elucidated, its function in maintaining membrane integrity and protein localization suggests it may contribute to the bacterium's ability to modulate host-microbe interactions. D. desulfuricans elevates serum S-adenosylmethionine (SAM) levels, which promotes chemoresistance by driving the expression of methyltransferase-like 3 (METTL3) . Properly functioning membrane proteins—dependent on lgt activity—may be essential for the bacterial metabolic pathways that generate these chemoresistance-promoting factors. This represents a promising avenue for further investigation into the mechanistic role of specific bacterial proteins in cancer treatment outcomes.

How does substrate specificity of Desulfovibrio lgt compare with other bacterial species?

The substrate specificity of Desulfovibrio lgt likely centers on recognition of the conserved lipobox motif (typically [LVI][ASTVI][GAS][C]) in prolipoprotein signal sequences. Comparative analyses between Desulfovibrio and other bacterial lgt enzymes reveal both conserved and divergent substrate recognition patterns. Unlike some bacterial species that show relaxed specificity, Desulfovibrio lgt may exhibit stricter requirements for the amino acid composition surrounding the critical cysteine residue in target prolipoproteins. This specificity likely relates to the unique membrane composition of sulfate-reducing bacteria and their adaptation to anaerobic environments. Structural modeling based on the amino acid sequence suggests that the substrate-binding pocket of Desulfovibrio lgt contains conserved regions for diacylglyceryl recognition alongside variable regions that may confer species-specific substrate preferences. These variations could influence the repertoire of lipoproteins successfully processed in different bacterial contexts.

What expression systems yield optimal results for recombinant Desulfovibrio desulfuricans lgt production?

For recombinant production of Desulfovibrio desulfuricans lgt, Escherichia coli-based expression systems with modifications for membrane protein expression typically yield the best results. The pET expression system with C43(DE3) or C41(DE3) host strains—specifically designed for membrane protein expression—offers advantages over standard BL21(DE3) strains. Expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to minimize inclusion body formation. For enhanced membrane integration, consider using pBAD vectors with fine-tunable arabinose induction. The full amino acid sequence should be preserved with minimal tag interference, particularly at the N-terminus which is critical for membrane insertion . Codon optimization may be necessary due to the high G+C content (approximately 60%) of Desulfovibrio genes compared to E. coli . Alternative expression systems like Pichia pastoris can be explored if bacterial expression proves challenging.

What purification strategies maximize yield and activity of recombinant Desulfovibrio lgt?

The purification of recombinant Desulfovibrio lgt requires specialized approaches due to its membrane-bound nature. A recommended protocol begins with membrane fraction isolation through differential centrifugation after cell lysis, followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration. Affinity chromatography using properly positioned tags (preferably C-terminal) allows for initial capture, followed by size exclusion chromatography to remove aggregates and achieve higher purity. Throughout purification, maintaining a buffer system containing 0.05-0.1% detergent, 50 mM Tris or phosphate, 150-300 mM NaCl, and 10% glycerol at pH 7.5-8.0 helps preserve enzyme activity . For optimal storage, the purified enzyme should be maintained in this buffer with 50% glycerol at -20°C, avoiding repeated freeze-thaw cycles that can dramatically reduce activity.

How can enzymatic activity of Desulfovibrio desulfuricans lgt be accurately measured?

Several complementary approaches can be employed to measure the enzymatic activity of Desulfovibrio desulfuricans lgt:

MethodPrincipleAdvantagesLimitations
Radioactive assayMeasures transfer of 14C or 3H-labeled diacylglycerol to substrate prolipoproteinHigh sensitivity, direct quantificationRequires radioisotope handling, specialized equipment
FRET-based assayUses fluorescently labeled substrate peptidesReal-time kinetics, no radioactivityPotential interference from detergents, lower sensitivity
Mass spectrometryDetects mass shift upon diacylglycerol additionPrecise product characterizationRequires sophisticated instrumentation, lower throughput
Western blot mobility shiftDetects gel mobility differences between modified and unmodified proteinsSimple equipment requirementsSemi-quantitative, indirect measurement

For standardized activity measurements, researchers should employ synthetic peptides containing the lipobox motif as substrates and phosphatidylglycerol as the diacylglycerol donor. Reaction conditions should include 50 mM HEPES buffer (pH 7.5), 150 mM NaCl, 0.1% DDM, and 10 mM MgCl2 at 30°C . Activity can be expressed as moles of diacylglyceryl transferred per minute per mg of enzyme under standard conditions, enabling comparison between different preparations.

What approaches can be used to study lgt inhibition and its effects on Desulfovibrio desulfuricans physiology?

Studying lgt inhibition provides insights into both bacterial physiology and potential therapeutic applications, particularly given Desulfovibrio's association with colorectal cancer chemoresistance . A multi-faceted approach includes:

  • Small molecule screening: High-throughput screening of compound libraries using the enzymatic assays described above can identify potential inhibitors. Natural product libraries may yield promising candidates based on successes with other bacterial targets.

  • Genetic approaches: CRISPR-Cas9 or antisense RNA technologies can downregulate lgt expression, allowing observation of phenotypic changes in D. desulfuricans. Conditional knockdown systems are particularly valuable for studying essential genes.

  • Physiological assessment: Following lgt inhibition, researchers should examine changes in membrane integrity, stress response, growth characteristics, and anaerobic respiration capacity. Particular attention should be paid to alterations in metabolite production, especially S-adenosylmethionine (SAM), given its role in cancer chemoresistance mechanisms .

  • Host-microbe interaction models: Co-culture systems with colorectal cancer cell lines can assess whether lgt inhibition affects the bacterium's ability to induce chemoresistance. Measurement of METTL3 expression in cancer cells following exposure to lgt-inhibited D. desulfuricans would provide valuable mechanistic insights into the role of this enzyme in host-microbe interactions relevant to cancer therapy .

How might structural determination of Desulfovibrio desulfuricans lgt advance therapeutic applications?

Determining the three-dimensional structure of Desulfovibrio desulfuricans lgt would significantly advance our understanding of its function and potential as a therapeutic target. Cryo-electron microscopy combined with molecular dynamics simulations represents the most promising approach for structural elucidation given the challenges of crystallizing membrane proteins. Structural insights would reveal the precise substrate-binding pocket architecture and catalytic mechanism, enabling structure-based drug design of specific inhibitors. Given D. desulfuricans' role in promoting colorectal cancer chemoresistance , lgt inhibitors could potentially serve as adjuvants to conventional chemotherapy, restoring drug sensitivity in patients with high Desulfovibrio abundance. Additionally, comparative structural analysis between Desulfovibrio lgt and human enzymes would help design selective inhibitors with minimal off-target effects. Researchers should prioritize identifying structural features unique to Desulfovibrio that can be exploited for therapeutic development while maintaining safety profiles.

What techniques can elucidate the role of lgt-modified proteins in Desulfovibrio-host interactions?

Understanding how lgt-modified proteins mediate interactions between Desulfovibrio desulfuricans and human hosts requires specialized techniques spanning proteomics, imaging, and functional studies:

  • Comparative lipoproteomic analysis: MS-based identification of the lipoproteome in wild-type versus lgt-inhibited D. desulfuricans can reveal the complete repertoire of modified proteins potentially involved in host interactions.

  • Bacterial-epithelial co-culture systems: Transwell and microfluidic co-culture platforms with intestinal epithelial cells can assess how lgt-modified surface proteins influence bacterial adhesion, invasion, and host cell signaling pathways.

  • CRISPR-dCas9 labeling: Fluorescent tagging of specific lgt-modified proteins combined with super-resolution microscopy can visualize their distribution during host-bacterial interactions.

  • In vivo studies: Gnotobiotic mouse models colonized with wild-type versus lgt-mutant D. desulfuricans allow examination of the role of lgt in gut colonization and influence on host metabolism, particularly in the context of colorectal cancer models treated with FOLFOX chemotherapy .

These approaches would help establish causal relationships between specific lgt-modified bacterial proteins and the observed abilities of D. desulfuricans to modulate host processes, including the production of S-adenosylmethionine (SAM) and subsequent METTL3-mediated chemoresistance in colorectal cancer.

How can researchers overcome expression and solubility challenges with recombinant Desulfovibrio desulfuricans lgt?

Membrane proteins like Desulfovibrio desulfuricans lgt present significant expression and solubility challenges. A systematic troubleshooting approach includes:

  • Expression vector optimization: Testing multiple promoter strengths, with preference for tightly controlled inducible systems that prevent premature protein expression and potential toxicity.

  • Fusion partner screening: Evaluating solubility-enhancing fusion partners such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) that can be later removed with specific proteases.

  • Host strain selection: Beyond standard C43/C41 strains, consider specialized strains like Lemo21(DE3) with tunable membrane protein expression capabilities or SHuffle strains for proteins with disulfide bonds.

  • Induction protocol modifications: Systematically varying temperature (12-30°C), inducer concentration (0.01-1.0 mM IPTG), and induction duration (4-24 hours) to identify optimal conditions.

  • Detergent screening: Testing a panel of detergents including DDM, LMNG, digitonin, and fluorinated surfactants for optimal solubilization while maintaining native-like folding.

Each optimization parameter should be tested independently while keeping other conditions constant, using small-scale expression tests (10-50 mL cultures) before scaling up production. Western blotting with anti-His or other tag-specific antibodies provides a rapid assessment of expression levels and solubility under different conditions.

What are the critical factors for maintaining enzymatic activity during storage and experimental manipulation?

Preserving the enzymatic activity of purified Desulfovibrio desulfuricans lgt requires careful attention to multiple factors:

Storage/Handling FactorRecommended ApproachScientific Rationale
TemperatureStore at -20°C for short-term, -80°C for long-termMinimizes protein denaturation and protease activity
Buffer composition50 mM Tris-HCl pH 7.5-8.0, 150-300 mM NaCl, 0.05-0.1% DDM, 50% glycerolMaintains protein stability and prevents aggregation
Freeze-thaw cyclesAliquot before freezing to avoid repeated cyclesPrevents denaturation at ice-water interfaces
Oxidation preventionInclude 1-5 mM DTT or 0.5-2 mM TCEPProtects critical cysteine residues from oxidation
Metal contaminationAdd 0.5-1 mM EDTAPrevents activity loss from heavy metal contamination
Microbial growthInclude 0.02% sodium azide for long-term storagePrevents contamination during storage

Activity measurements should be performed immediately after thawing, and working stocks should be maintained at 4°C for no more than one week with minimal exposure to light . Temperature sensitivity studies show that most recombinant lgt proteins retain >90% activity after 3 months at -80°C but lose significant activity when stored above 4°C for extended periods. Researchers should validate each new protein preparation against a reference standard to establish baseline activity before experimental use.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.