Recombinant Desulfovibrio desulfuricans Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
crcB; Ddes_1125; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)
Target Names
crcB
Target Protein Sequence
MLKTLALISIGASCGAILRWFLGLMLNAIFLPIPLGTLAANLLGGYLIGVAVSMFNALSA VGPEFRLLIITGFLGGLTTFSTFTAEIGVLLQGQRIMTAVAAIVLHVCGSLIMMLLGMGT FALLRTCFR
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Desulfovibrio desulfuricans and where is it naturally found?

Desulfovibrio desulfuricans is an anaerobic, sulfate-reducing, nonfermenting, Gram-negative bacterium. It is ubiquitously found in soil, water, sewage, and the digestive tracts of animals and humans. In clinical contexts, it has been associated with bacteremia and abdominal infections, particularly in immunocompromised patients . The bacterium is characterized by slow growth patterns (4-7 days for isolation) and specialized metabolic requirements, making it challenging to culture and identify using conventional microbiological methods .

What is the CrcB homolog protein and what is its putative function?

The CrcB homolog in D. desulfuricans is believed to function as a fluoride ion channel. While specific information about D. desulfuricans CrcB is limited in the provided references, CrcB proteins generally form fluoride-selective ion channels that protect bacteria from the toxic effects of environmental fluoride by exporting it from the cell. This protection mechanism is crucial for bacterial survival in environments containing fluoride, which can inhibit enzymes involved in phosphoryl transfer and nucleic acid processing.

What genetic manipulation systems are available for Desulfovibrio species?

Several genetic manipulation systems have been developed for Desulfovibrio species, particularly D. vulgaris Hildenborough, which can potentially be adapted for D. desulfuricans. These include:

  • Chloramphenicol and kanamycin marker exchange mutagenesis methods

  • In-frame markerless deletion systems using counterselectable markers like sacB

  • Two-step recombination processes for gene deletion

  • Gateway vector systems for facile construction of mutagenic vectors

The development of these systems has significantly improved the genetic manipulation capabilities in Desulfovibrio species in recent years, allowing for the construction of gene deletions and potential sequential mutations .

What plasmid systems are effective for recombinant protein expression in D. desulfuricans?

Based on the research with related Desulfovibrio species, shuttle vectors containing both E. coli and Desulfovibrio replicons have proven effective. For example, the pMO719 plasmid was constructed as a shuttle vector containing the E. coli replicon with spectinomycin resistance and the Desulfovibrio desulfuricans G100A replicon from the cryptic plasmid pBG1 . This type of construct allows for replication in both E. coli (for ease of manipulation) and Desulfovibrio species (for expression).

How can I optimize transformation efficiency when introducing recombinant plasmids into D. desulfuricans?

For optimal transformation of D. desulfuricans, electroporation has shown effectiveness. The protocol described in the literature involves:

  • Growing cells to an optimal optical density (OD600) of 0.4-0.6

  • Washing cells with chilled electroporation buffer (30 mM Tris-HCl, pH 7.2)

  • Concentrating cells and adding plasmid DNA prior to electroporation

The timing of harvest (mid-logarithmic phase) and proper washing steps are critical for achieving optimal transformation efficiency. Additionally, performing all manipulations quickly and keeping cells chilled throughout the process helps maintain cell viability and competence.

How does the structure of D. desulfuricans CrcB compare to characterized CrcB proteins from other organisms?

While the search results don't provide specific structural information about D. desulfuricans CrcB, structural studies of CrcB homologs in other organisms suggest that they typically form dimers with dual-topology membrane proteins featuring four transmembrane helices per monomer. Researchers studying D. desulfuricans CrcB would need to employ techniques such as X-ray crystallography or cryo-electron microscopy to determine its specific structure and compare it to known structures of CrcB homologs from model organisms.

What experimental approaches are most effective for measuring fluoride transport activity of recombinant CrcB?

To measure fluoride transport activity of recombinant CrcB from D. desulfuricans, researchers might employ several complementary approaches:

  • Fluoride electrode-based flux assays in reconstituted proteoliposomes

  • Fluoride-sensitive fluorescent probes to monitor intracellular fluoride levels

  • Isotope-labeled fluoride (18F) to track transport in whole cells or membrane vesicles

  • Electrophysiological approaches using patch-clamp techniques on reconstituted membranes

These approaches should be complemented with appropriate controls, including membrane vesicles without the recombinant protein and vesicles with known fluoride transport proteins.

What is the relationship between CrcB function and D. desulfuricans survival in fluoride-rich environments?

To investigate this relationship, researchers should design experiments comparing wild-type and crcB knockout strains of D. desulfuricans in media containing varying concentrations of fluoride. Growth curves, survival assays, and transcriptomic analysis would help elucidate how CrcB contributes to fluoride resistance. Given that D. desulfuricans is found in diverse environments including water systems that may contain fluoride, understanding this relationship could provide insights into the ecological adaptations of this organism.

What specialized techniques are required for culturing D. desulfuricans for protein expression studies?

D. desulfuricans requires strict anaerobic conditions for growth. Researchers should employ:

  • Anaerobic chambers or specialized cultivation vessels

  • Pre-reduced media containing appropriate electron donors and sulfate as terminal electron acceptor

  • Oxygen scavengers and redox indicators to maintain and monitor anaerobic conditions

  • Careful temperature control, typically at 37°C for optimal growth

The indolent growth pattern of D. desulfuricans (4-7 days) necessitates patience during culturing processes . Additionally, media should be supplemented with appropriate antibiotics when working with recombinant strains carrying selection markers.

How can I verify successful expression of recombinant CrcB in D. desulfuricans?

Verification of recombinant CrcB expression can be accomplished through several complementary techniques:

  • Western blotting using antibodies against epitope tags (if incorporated) or against the CrcB protein itself

  • Reverse transcription PCR (RT-PCR) to detect increased crcB transcript levels

  • Mass spectrometry-based proteomic analysis of membrane fractions

  • Functional assays measuring increased fluoride resistance in the recombinant strain

A combination of these approaches provides stronger evidence for successful expression than any single method alone.

What are the most effective protein purification strategies for obtaining functional CrcB from D. desulfuricans?

Given the membrane-associated nature of CrcB proteins, an effective purification strategy would include:

  • Careful cell lysis under anaerobic conditions

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity chromatography using incorporated tags (His-tag, FLAG-tag)

  • Size exclusion chromatography for final purification

The choice of detergent is critical for maintaining protein functionality, and screening multiple detergents may be necessary to identify optimal conditions.

How should experiments be designed to analyze the physiological role of CrcB in D. desulfuricans?

A comprehensive experimental design should include:

  • Construction of crcB deletion mutants using markerless deletion systems

  • Complementation studies with wild-type and mutant crcB variants

  • Phenotypic characterization under various stress conditions (fluoride, other halides)

  • Transcriptomic and proteomic analysis comparing wild-type and mutant strains

  • Metabolic flux analysis to identify pathways affected by crcB deletion

This multifaceted approach allows for a comprehensive understanding of CrcB's physiological role beyond its presumed function in fluoride transport.

What control strains should be included when characterizing recombinant D. desulfuricans expressing CrcB?

When characterizing recombinant D. desulfuricans expressing CrcB, researchers should include:

  • Wild-type D. desulfuricans (baseline control)

  • D. desulfuricans with empty expression vector (to control for vector effects)

  • D. desulfuricans expressing a known non-functional CrcB variant (negative control)

  • D. desulfuricans expressing a well-characterized CrcB homolog from another organism (positive control)

These controls help distinguish between effects specifically due to functional CrcB expression versus non-specific effects from the experimental system.

How can contradictory experimental results in CrcB characterization be reconciled?

When faced with contradictory results in CrcB characterization, researchers should:

  • Systematically evaluate experimental conditions that differ between contradictory experiments

  • Consider strain-specific variations that might influence protein function

  • Examine whether post-translational modifications affect protein activity

  • Assess whether environmental factors (pH, ion concentrations) might explain the discrepancies

  • Perform independent validation using alternative methodological approaches

A systematic evaluation of methodological differences often resolves apparent contradictions in experimental results.

Does CrcB expression influence antibiotic susceptibility in D. desulfuricans?

While direct evidence linking CrcB to antibiotic susceptibility in D. desulfuricans is not provided in the search results, it's a relevant research question. Membrane transport proteins can sometimes influence antibiotic uptake or efflux. Researchers could investigate this by comparing antibiotic susceptibility profiles of wild-type and crcB mutant strains.

The table below summarizes known antibiotic susceptibility of D. desulfuricans based on available data:

AntibioticSusceptibilityMIC Value
ClindamycinSusceptible<0.016 mg/liter
MetronidazoleSusceptible<0.016 mg/liter
ErythromycinSusceptible1.0 mg/liter
Amoxicillin-clavulanic acidSusceptible0.047 mg/liter
MeropenemSusceptible0.006 mg/liter
Piperacillin-tazobactamResistant>256 mg/liter
ClarithromycinEffective in clinical caseNot determined

This susceptibility profile could serve as a baseline for comparing crcB mutant strains .

What is the potential role of D. desulfuricans and CrcB in clinical infections?

D. desulfuricans has been identified as an opportunistic pathogen, particularly in immunocompromised hosts. The bacterium has been associated with bacteremia and abdominal infections, including cases in patients with ulcerative colitis . While the specific role of CrcB in pathogenicity is not established, membrane transport proteins can contribute to bacterial survival under host-imposed stress conditions. Research into whether CrcB contributes to pathogenicity could explore its role in survival within host tissues, especially in environments where fluoride might be present.

What are promising approaches for studying protein-protein interactions involving CrcB in D. desulfuricans?

Promising approaches for studying CrcB protein-protein interactions include:

  • Bacterial two-hybrid systems adapted for anaerobic bacteria

  • Co-immunoprecipitation followed by mass spectrometry

  • Chemical cross-linking combined with proteomics

  • FRET-based assays using fluorescently tagged proteins

  • Split-reporter systems (e.g., split-GFP) to visualize interactions in vivo

These approaches could help identify protein complexes involving CrcB and elucidate its functional interactions within the cellular context.

How might CrcB homologs from D. desulfuricans be utilized in synthetic biology applications?

CrcB homologs could potentially be utilized in several synthetic biology applications:

  • Development of fluoride biosensors by coupling CrcB to reporter systems

  • Engineering of microorganisms for bioremediation of fluoride-contaminated environments

  • Creation of selective membrane transport systems in synthetic cells

  • Design of fluoride-responsive genetic circuits using CrcB as a sensor component

These applications would require thorough characterization of the protein's function, regulation, and structural properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.