Recombinant Desulfovibrio desulfuricans Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Desulfovibrio desulfuricans Undecaprenyl-diphosphatase (uppP)

Recombinant Desulfovibrio desulfuricans Undecaprenyl-diphosphatase (uppP) is a bacterially derived enzyme critical for cell wall biosynthesis. This recombinant protein is engineered for research applications, enabling detailed study of its structure, function, and potential therapeutic targeting . Produced via E. coli expression systems, it retains a His-tag for purification and is available in Tris-based storage buffers with glycerol .

Biological Role of Undecaprenyl-diphosphatase (uppP)

Undecaprenyl-diphosphatase catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a carrier lipid essential for peptidoglycan and lipopolysaccharide synthesis in bacterial cell walls . Key functions include:

  • Bacitracin Resistance: Bacitracin binds UPP, blocking cell wall assembly; uppP activity regenerates UP, mitigating antibiotic effects .

  • Metabolic Regulation: Linked to nitrate reductase operons in Desulfovibrio, suggesting interplay with stress-response pathways during sulfate deprivation .

Production and Purification

Recombinant uppP is produced under optimized conditions:

  • Expression System: E. coli C41 (DE3) with isopropyl β-d-thiogalactoside (IPTG) induction .

  • Purification: Nickel-affinity chromatography via N-terminal His-tag .

  • Storage: Tris-based buffer with 50% glycerol at -20°C; avoid repeated freeze-thaw cycles .

Enzymatic Activity and Mutagenesis

  • Catalytic Efficiency: Wild-type uppP exhibits a k<sub>cat</sub> of 0.12 s<sup>-1</sup> and K<sub>m</sub> of 18 µM for UPP .

  • Active-Site Mutants: Substitutions in (E/Q)XXXE motifs (e.g., E142A) reduce activity by >90%, confirming their role in catalysis .

Applications in Research

  • Antibiotic Development: Target for novel inhibitors against Desulfovibrio and related pathogens .

  • Cell Wall Studies: Used to dissect lipid carrier recycling mechanisms in Gram-negative bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. Should you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point for customers.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
uppP; Ddes_1418; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)
Target Names
uppP
Target Protein Sequence
MDNLLTALILSIVEGLTEFLPVSSSGHLILAGDLLGFVGEKAATFDVVIQLGAIMAVVVL YWKRFWGLVRPQPYARFAGRRGIVLLMLTSLPACILGLLLHAYIKEYLFRPATVLIALVV GAICMILVEKRKFKPTCISLDDMTPRLALGIGCFQCLALWPGFSRSAATIMGGMLLGAKR PLAAEYSFIAAVPIMVAATGYDLLKNLSMFTAADIPFFLVGMIGSFVSALLAVKVFVALV GRMTLIPFACYRLLIAPFVYYFMVN
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Undecaprenyl-diphosphatase (uppP) in bacterial cell physiology?

Undecaprenyl-diphosphatase (uppP) catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in bacterial cell wall synthesis . This enzymatic activity is crucial for the recycling of the lipid carrier, enabling continuous peptidoglycan synthesis. The process is particularly important for maintaining cell wall integrity and bacterial survival. The enzyme belongs to a class of integral membrane proteins with the enzyme classification EC 3.6.1.27 . Understanding uppP function provides insights into fundamental bacterial physiological processes and potential vulnerabilities that could be exploited for antimicrobial development.

What are the optimal storage and handling conditions for recombinant Desulfovibrio desulfuricans uppP?

Recombinant Desulfovibrio desulfuricans uppP should be stored at -20°C for regular use, while extended storage should be at -20°C or -80°C for maximum stability . The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein. To maintain enzyme activity, repeated freezing and thawing cycles should be strictly avoided as they can cause protein denaturation and activity loss. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw damage . When handling the protein, researchers should use appropriate sterile techniques and consider adding protease inhibitors if working with sensitive applications that require extended manipulation periods.

How does the amino acid sequence of D. desulfuricans uppP compare with uppP from other bacterial species?

The D. desulfuricans uppP consists of 265 amino acids and shows significant sequence similarities and differences when compared to other bacterial species such as D. vulgaris. The amino acid sequence of D. desulfuricans uppP (UniProt ID: B8J0P3) begins with: MDNLLTALILSIVEGLTEFLPVSSSGHLILAGDLLGFVGEKAATFDVVIQLGAIMAVVVL and continues through the full 265-residue sequence . When compared with D. vulgaris uppP (UniProt ID: A1VDC9), which also contains 265 amino acids, there are notable similarities in the N-terminal region, with both sequences beginning with conserved hydrophobic residues that likely contribute to membrane association . Sequence alignment reveals functional motifs that are conserved across bacterial species, including glutamate-rich regions that are proposed to be involved in the catalytic mechanism . These comparative analyses provide valuable insights into structure-function relationships and evolutionary conservation of this important enzyme across different bacterial species.

What methodologies are most effective for analyzing the membrane topology and structure-function relationships of uppP?

Investigating membrane topology and structure-function relationships of uppP requires a multi-faceted approach combining biochemical, biophysical, and computational methods. Membrane topology can be effectively probed using techniques such as cysteine scanning mutagenesis followed by accessibility studies with membrane-impermeable sulfhydryl reagents. For structural studies, researchers should consider X-ray crystallography of detergent-solubilized protein or cryo-electron microscopy, although obtaining high-resolution structures of membrane proteins remains challenging. Functional analysis can be performed using phosphatase activity assays with synthetic substrate analogs that mimic the natural undecaprenyl pyrophosphate substrate.

The consensus regions containing glutamate-rich (E/Q) sequences identified in uppP suggest important catalytic or substrate-binding domains . Site-directed mutagenesis targeting these conserved residues, followed by activity assays, can elucidate their specific roles in catalysis. Molecular dynamics simulations can complement experimental approaches by providing insights into protein dynamics, substrate binding, and the influence of the membrane environment on protein function. When designing structure-function experiments, researchers should consider the integral membrane nature of uppP and ensure that experimental conditions maintain the native protein conformation.

How does D. desulfuricans uppP contribute to antibiotic resistance mechanisms?

Undecaprenyl pyrophosphate phosphatase (uppP) contributes to antibiotic resistance through its role in cell wall synthesis and specific interactions with antibiotics targeting this pathway. As an alternative name suggests ("Bacitracin resistance protein"), uppP plays a role in resistance to bacitracin, which acts by binding to undecaprenyl pyrophosphate and preventing its dephosphorylation . By catalyzing the rapid conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, uppP reduces the availability of the bacitracin target, thereby conferring resistance.

Research on Desulfovibrio species indicates varying antibiotic susceptibility profiles that may relate to differences in cell wall synthesis enzymes including uppP. D. desulfuricans has been reported to be susceptible to chloramphenicol, metronidazole, imipenem, and clindamycin while showing resistance to penicillin . In contrast, D. vulgaris appears more broadly susceptible to antibiotics, including penicillin . This suggests species-specific differences in cell wall synthesis and antibiotic interaction that may involve variations in uppP activity or regulation. Research investigating the correlation between uppP expression levels, enzyme activity variants, and antibiotic resistance phenotypes could provide valuable insights for developing targeted antimicrobial strategies against Desulfovibrio species.

What experimental approaches can differentiate between the catalytic mechanisms of uppP from D. desulfuricans versus other bacterial species?

Differentiating between catalytic mechanisms of uppP from different bacterial species requires sophisticated enzyme kinetic approaches. Researchers should employ steady-state kinetics using artificial substrates that mimic undecaprenyl pyrophosphate to determine and compare key parameters such as Km, kcat, and catalytic efficiency (kcat/Km) between D. desulfuricans uppP and homologs from other species such as D. vulgaris. pH-rate profiles can reveal ionizable groups critical for catalysis, while solvent isotope effects may indicate proton transfer in the rate-limiting step.

Inhibition studies using transition state analogs or substrate analogs can provide insights into binding site architecture differences. Metal ion dependency studies are particularly valuable, as many phosphatases require specific metal cofactors. Site-directed mutagenesis targeting the conserved glutamate-rich regions should be systematically conducted to compare the effects of equivalent mutations across species . Pre-steady-state kinetics using rapid mixing techniques can identify differences in individual steps of the catalytic cycle. Product inhibition patterns may reveal variations in the order of substrate binding and product release. For more detailed mechanistic insights, researchers could employ techniques such as Fourier-transform infrared spectroscopy (FTIR) to monitor phosphate group vibrational changes during catalysis, potentially revealing species-specific differences in the transition state structure.

What are the best practices for recombinant expression and purification of functional D. desulfuricans uppP?

Successful recombinant expression and purification of functional D. desulfuricans uppP require careful consideration of its membrane protein nature. For optimal expression, researchers should select expression systems that can handle membrane proteins, such as specialized E. coli strains (C41(DE3) or C43(DE3)) designed for toxic or membrane protein expression. The gene sequence should be codon-optimized for the expression host, and expression vectors providing appropriate fusion tags (His6, MBP, or SUMO) can enhance solubility and facilitate purification.

Induction conditions require optimization, typically using lower temperatures (16-20°C) and reduced inducer concentrations to slow protein production and allow proper membrane insertion. For extraction, mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or lauryl maltose neopentyl glycol (LMNG) are recommended to maintain protein stability and activity. Purification should employ a multi-step approach, beginning with affinity chromatography based on the fusion tag, followed by size exclusion chromatography to remove aggregates and ensure monodispersity. Throughout the purification process, it's crucial to maintain detergent concentrations above their critical micelle concentration (CMC) to prevent protein aggregation. Quality control should include SDS-PAGE analysis, mass spectrometry for identity confirmation, and critically, activity assays to verify that the purified protein retains its native phosphatase function.

What phosphatase activity assay methods are most reliable for quantifying uppP enzyme activity?

Several complementary methods can be employed for reliable quantification of uppP enzyme activity. The malachite green assay represents a sensitive colorimetric method for detecting inorganic phosphate released during the dephosphorylation reaction. This assay offers high sensitivity (detection limit ~50 pmol) and is compatible with various buffer systems, making it suitable for kinetic studies. Alternatively, researchers can use fluorescent substrate analogs containing umbelliferone phosphate groups, which become fluorescent upon dephosphorylation, allowing continuous real-time monitoring of enzyme activity.

For more specialized applications, radioactive assays utilizing 32P-labeled substrates offer exceptional sensitivity and specificity. When designing activity assays, researchers must carefully consider buffer composition, particularly pH (typically 6.5-8.0 for optimal activity) and the presence of divalent cations like Mg2+ or Mn2+ that may be required for activity. Detergent concentration is critical, as it must be sufficient to maintain protein solubility without inhibiting activity. Control experiments should include heat-inactivated enzyme and reactions with known phosphatase inhibitors to verify specificity. When comparing activities across different preparations or mutants, it's essential to normalize data to protein concentration determined by methods compatible with detergent-solubilized proteins, such as the bicinchoninic acid (BCA) assay.

How can researchers effectively study the interaction between D. desulfuricans uppP and potential inhibitors?

Studying interactions between D. desulfuricans uppP and potential inhibitors requires a systematic approach combining biochemical, biophysical, and computational methods. Initial screening can be conducted using enzyme activity assays in the presence of different inhibitor concentrations to determine IC50 values. Detailed inhibition kinetics should follow, determining inhibition constants (Ki) and elucidating inhibition mechanisms (competitive, non-competitive, or uncompetitive) through Lineweaver-Burk or Dixon plots.

Binding interactions can be directly measured using techniques such as isothermal titration calorimetry (ITC), which provides thermodynamic parameters including binding affinity, enthalpy, and stoichiometry. Surface plasmon resonance (SPR) offers an alternative approach that can assess binding kinetics (kon and koff rates). For structural insights into inhibitor binding, researchers should consider nuclear magnetic resonance (NMR) spectroscopy for smaller protein fragments or X-ray crystallography of protein-inhibitor complexes when feasible.

Computational approaches including molecular docking and molecular dynamics simulations can complement experimental methods by predicting binding modes and interaction energies. Structure-activity relationship (SAR) studies involving systematic modification of inhibitor chemical structures and correlation with inhibitory potency can guide rational inhibitor design. When evaluating inhibitors with therapeutic potential, researchers should assess specificity by testing against human phosphatases and determine efficacy in bacterial culture systems by measuring growth inhibition in the presence of the inhibitor, particularly under conditions where uppP function is essential.

What are the primary technical challenges in studying D. desulfuricans uppP and how might researchers overcome them?

The study of D. desulfuricans uppP faces several significant technical challenges primarily related to its integral membrane protein nature. Obtaining sufficient quantities of properly folded protein represents a major obstacle, as membrane proteins often express poorly or form inclusion bodies. Researchers can address this by exploring alternative expression systems such as yeast (Pichia pastoris) or insect cells that may better accommodate membrane protein expression. Another approach involves systematic screening of expression conditions including temperature, induction timing, and media composition to optimize yields of functional protein.

The hydrophobic nature of uppP creates difficulties in maintaining protein stability during purification and subsequent experiments. Researchers should systematically screen detergents and lipid environments, considering newer amphipathic polymers like styrene-maleic acid (SMA) that can extract membrane proteins with their native lipid environment intact. The development of nanodiscs or other membrane mimetics may provide more native-like environments for functional studies.

Another significant challenge involves the limited availability of suitable substrates for enzymatic assays. Natural undecaprenyl pyrophosphate is difficult to obtain in quantities needed for extensive biochemical studies. Researchers could address this by developing synthetic substrate analogs with improved stability and accessibility, possibly incorporating fluorescent or chromogenic groups for easier detection of enzymatic activity. Collaborative approaches involving synthetic chemists and enzymologists could facilitate the development of these specialized research tools that would benefit the broader field of bacterial cell wall biogenesis research.

How might research on D. desulfuricans uppP contribute to novel antimicrobial development strategies?

Research on D. desulfuricans uppP presents several promising avenues for antimicrobial development. As an essential enzyme in bacterial cell wall synthesis, uppP represents a potentially valuable target for new antibiotics, particularly important in the context of rising antimicrobial resistance. Structure-based drug design targeting uppP could lead to novel inhibitors that disrupt bacterial cell wall synthesis. The existence of structural and mechanistic differences between bacterial phosphatases and their human counterparts offers opportunities for developing selective inhibitors with minimal host toxicity.

Combination therapy approaches are particularly promising, as uppP inhibitors could potentially synergize with existing antibiotics like bacitracin that target related steps in the cell wall synthesis pathway . By blocking both the target (undecaprenyl pyrophosphate) and the resistance mechanism (uppP-mediated dephosphorylation), such combinations might overcome existing resistance mechanisms.

Comparative studies of uppP across different bacterial species, including pathogens like D. desulfuricans that have been implicated in human infections , could reveal species-specific features that might be exploited for selective targeting. The observed variations in antibiotic susceptibility between Desulfovibrio species suggest potential differences in cell wall synthesis that might correlate with uppP structure or function . Furthermore, understanding the role of uppP in the context of bacterial infection models could provide insights into its importance during host colonization and infection, potentially revealing context-dependent vulnerabilities that might be exploited therapeutically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.