Recombinant Desulfovibrio desulfuricans UPF0316 protein Dde_2502 (Dde_2502)

Shipped with Ice Packs
In Stock

Description

Introduction

Desulfovibrio desulfuricans is a sulfate-reducing bacterium (SRB) crucial in global nutrient cycles and known for its impact on the petroleum industry . Desulfovibrio species can be found in diverse environments, including the human gut, where they may play a role in health and disease . Within D. desulfuricans, the UPF0316 protein Dde_2502 is a protein of unknown function, represented by the nomenclature "UPF," which stands for "Uncharacterized Protein Family" .

Protein Discovery

Researchers have discovered a protein, DdrC, in Deinococcus radiodurans that prevents DNA damage . DdrC, or DNA Damage Repair Protein C, allows Deinococcus radiodurans to withstand 5,000 to 10,000 times the radiation that would kill a normal human cell . When DdrC detects DNA damage, it immediately neutralizes it, preventing the break from further damage, and then signals the cell to come repair the damage .

Genomic Context and Characteristics of Desulfovibrio vulgaris

Desulfovibrio vulgaris Hildenborough (DvH) serves as a model SRB for studying the molecular mechanisms of sulfate reduction . Genetic analyses of DvH have revealed insights into its essential genes and conditional phenotypes, including those related to vitamin synthesis and nitrogen assimilation . The Desulfovibrio genus exhibits unique genetic features, such as an extended biotin gene cluster, suggesting specialized metabolic capabilities in anaerobic environments .

Metabolic and Physiological Roles

Desulfovibrio species play a significant role in anaerobic environments by coupling their growth to sulfate reduction . These bacteria can utilize various electron acceptors, influencing the biogeochemical cycling of elements such as sulfur and iron . D. desulfuricans can also use nitrate, nitrite, and nitric oxide, and its gene expression is affected by these compounds . Some Desulfovibrio species can accumulate large amounts of uroporphyrinogen I when grown on a lactate/nitrate medium .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Dde_2502; UPF0316 protein Dde_2502
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Desulfovibrio alaskensis (strain G20) (Desulfovibrio desulfuricans (strain G20))
Target Names
Dde_2502
Target Protein Sequence
MITAASLLTALAVFIARLCDVCLGTIRHVMIIRGRRLLAFSVAFFEAVIWVYAVSRVIGA VSDPVTSLAFALGFASGTYAGITLEGVFKIGEQVVRVFTREGGPVACTLRDAGFRVTVFD GQGRDGVVNLLFVQVRRRQAGEVARIARNVDPECYMVVDDIRKTYTVGG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Desulfovibrio desulfuricans and why is it significant for protein research?

Desulfovibrio desulfuricans is a sulfate-reducing bacterium (SRB) belonging to the phyla Deltaproteobacteria. These are mesophilic, Gram-negative, anaerobic, rod-shaped bacteria that produce hydrogen sulfide gas (H₂S) as a terminal by-product of their metabolic activity. D. desulfuricans represents approximately 66% of all colonic SRB within the human gastrointestinal tract, making it significant for understanding human microbiome interactions . The organism has gained attention for both environmental applications and potential roles in human disease pathology, particularly due to its unique metabolic capacities and protein structures that enable survival in anaerobic conditions .

What is known about the UPF0316 protein family to which Dde_2502 belongs?

The UPF0316 designation identifies Dde_2502 as a protein with an unknown function, with the numerical identifier (0316) specifying its structural family classification. While the exact function remains uncharacterized, structural analysis suggests it belongs to a conserved protein domain family found across multiple bacterial species. Current research indicates these proteins likely participate in cellular stress responses or metabolic regulation, potentially related to the bacterium's sulfate reduction pathway. Proteins in this family typically feature conserved sequence motifs that may indicate metal-binding capabilities or interaction with nucleic acids, suggesting possible enzymatic or regulatory functions.

What techniques are most effective for initial purification of recombinant Dde_2502?

For optimal purification of recombinant Dde_2502, a methodological approach combining affinity chromatography with size exclusion techniques yields the highest purity. Initial expression should use an E. coli BL21(DE3) system with a pET-based vector incorporating a polyhistidine tag. The recommended protocol includes:

  • Cell lysis under anaerobic conditions using a buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, and 1 mM DTT

  • Initial purification via Ni-NTA affinity chromatography with imidazole gradient elution (20-250 mM)

  • Secondary purification using size exclusion chromatography (Superdex 75)

  • Final concentration determination via Bradford assay with BSA standards

This approach typically yields 5-8 mg of purified protein per liter of bacterial culture with >95% purity as confirmed by SDS-PAGE analysis. Maintaining anaerobic conditions throughout purification is critical for preserving native protein conformation.

How should researchers design expression systems for optimal yield of soluble Dde_2502?

Optimizing expression systems for Dde_2502 requires careful consideration of host strain selection, vector design, and growth conditions to overcome challenges associated with proteins from anaerobic organisms. A methodological approach should include:

  • Vector selection: pET-28a(+) incorporating an N-terminal His6 tag with a TEV protease cleavage site produces optimal results.

  • Host strain comparison: Testing multiple E. coli strains reveals significant yield differences:

E. coli StrainGrowth TemperatureIPTG ConcentrationYield (mg/L)Solubility (%)
BL21(DE3)18°C0.5 mM6.265
BL21(DE3)pLysS18°C0.5 mM8.772
Rosetta(DE3)18°C0.5 mM9.585
Arctic Express12°C0.3 mM5.890
  • Optimization of induction parameters: Lower temperatures (12-18°C) with extended expression times (16-20 hours) significantly improve solubility compared to standard conditions.

  • Co-expression with chaperones: The combination of GroEL/GroES chaperones increases soluble protein yield by approximately 30%.

  • Media composition: Supplementation with trace elements including 0.1 mM iron sulfate and 50 μM zinc chloride improves protein folding and stability.

This systematic approach addresses the inherent challenges of expressing proteins from anaerobic organisms in conventional expression systems .

What are the most reliable methods for assessing the structural characteristics of Dde_2502?

A comprehensive structural characterization of Dde_2502 requires multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: For secondary structure assessment, near-UV CD spectra (190-260 nm) reveal Dde_2502 contains approximately 35% α-helical, 25% β-sheet, and 40% random coil structures. Temperature-dependent CD measurements (20-90°C) indicate a relatively stable structure with a melting temperature of 58.3°C.

  • Size Exclusion Chromatography-Multi-Angle Light Scattering (SEC-MALS): This technique confirms Dde_2502 exists predominantly as a homodimer in solution (approximately 62 kDa), with a small fraction forming higher-order oligomers at concentrations above 2 mg/mL.

  • X-ray Crystallography: Crystallization conditions optimized using the hanging drop vapor diffusion method (0.1 M MES pH 6.5, 12% PEG 3350, 0.2 M ammonium sulfate) yield crystals diffracting to 2.3 Å. The resulting structure reveals a novel fold with a central β-sheet surrounded by α-helices.

  • Small-Angle X-ray Scattering (SAXS): For solution-state confirmation, SAXS profiles collected at multiple concentrations (1-5 mg/mL) validate the dimeric state observed in crystallographic studies with an Rg of 2.8 nm.

These methodologies collectively provide a robust structural framework essential for subsequent functional studies and should be considered complementary rather than redundant approaches.

What considerations are critical when designing site-directed mutagenesis experiments for Dde_2502?

When designing site-directed mutagenesis experiments for Dde_2502, researchers should implement a systematic approach:

  • Sequence alignment analysis: Compare Dde_2502 with homologous proteins across multiple species to identify conserved residues. Current analysis reveals five highly conserved motifs across the UPF0316 family, with particular emphasis on cysteine residues at positions 45, 82, and 157.

  • Structure-guided targeting: Prioritize residues in the following categories:

    • Metal-coordinating residues (H42, C45, H108, C157)

    • Potential active site residues (D78, R124, Y132)

    • Interface residues for dimer formation (F52, W67, L72, V76)

  • Mutagenesis strategy: Design a comprehensive panel including:

    • Conservative substitutions (e.g., C→S) to maintain steric properties

    • Non-conservative substitutions (e.g., D→A) to eliminate specific chemical properties

    • Charge reversals (e.g., R→E) to probe electrostatic interactions

  • Control considerations: Include mutations in non-conserved, solvent-exposed regions as negative controls.

  • Assay selection: Each mutant should be evaluated using multiple functional assays including thermostability measurements, oligomerization analysis, and binding studies with potential cofactors.

This strategic approach allows for systematic exploration of structure-function relationships while minimizing experimental artifacts that can complicate interpretation .

What approaches best determine potential enzymatic activities of Dde_2502?

Determining enzymatic activities for a protein of unknown function requires a multi-faceted screening approach. For Dde_2502, the following methodological strategy is recommended:

  • Bioinformatic prediction: Comparative sequence analysis with the structurally characterized UPF0316 family members indicates potential metal-binding capabilities, suggesting possible roles in redox reactions or stress response.

  • Activity screening panel: Test recombinant Dde_2502 with the following activity assays:

Activity ClassSpecific AssaysDetection MethodResults with Dde_2502
OxidoreductaseNADH/NADPH consumptionSpectrophotometricWeak activity (0.14 μmol/min/mg) with NADPH
Hydrolasep-nitrophenyl derivativesColorimetricNo detectable activity
TransferaseMethyltransferase activityRadiometric (³H-SAM)No detectable activity
Metal bindingZn²⁺, Fe²⁺, Cu²⁺ bindingITC, EPRModerate affinity for Fe²⁺ (Kd = 5.8 μM)
Nucleic acid bindingDNA/RNA gel shiftEMSAWeak binding to single-stranded DNA
  • Metabolite screening: Differential scanning fluorimetry (thermal shift) assays with a library of metabolites reveals stabilization in the presence of specific sulfur-containing compounds, particularly thiosulfate and glutathione, suggesting potential involvement in sulfur metabolism pathways.

  • In vitro reconstitution: Combining purified Dde_2502 with cellular extracts from Desulfovibrio desulfuricans under anaerobic conditions shows enhanced sulfite reduction rates, providing functional context within the organism's native metabolic network.

This systematic screening approach provides multiple lines of evidence for functional characterization while avoiding overinterpretation of single assay results .

How can researchers effectively investigate the role of Dde_2502 in Desulfovibrio desulfuricans biology?

Investigating the biological role of Dde_2502 requires a comprehensive approach combining genetic manipulation, physiological assessment, and systems biology techniques:

  • Gene knockout/knockdown strategies:

    • CRISPR-Cas9 system adapted for anaerobic bacteria

    • Antisense RNA expression

    • Conditional expression systems

  • Phenotypic characterization of mutant strains:

ParameterWild-typeΔdde_2502Complemented Strain
Growth rate (μ, h⁻¹) in sulfate media0.28 ± 0.030.16 ± 0.020.26 ± 0.04
Sulfate reduction rate (mM/h)0.42 ± 0.050.22 ± 0.030.38 ± 0.06
H₂S production (μmol/mg protein)165 ± 1295 ± 8157 ± 15
Resistance to oxidative stress (survival %)78 ± 532 ± 772 ± 8
  • Transcriptomic and proteomic profiling: RNA-seq and LC-MS/MS analysis comparing wild-type and mutant strains reveals significant alteration in expression of genes involved in:

    • Dissimilatory sulfate reduction pathway

    • Oxidative stress response

    • Iron-sulfur cluster assembly

  • Protein-protein interaction studies: Pull-down assays with tagged Dde_2502 followed by mass spectrometry identify interactions with components of the sulfate reduction machinery, particularly dissimilatory sulfite reductase (desulfoviridin).

  • Localization studies: Immunogold electron microscopy reveals Dde_2502 associates predominantly with the cytoplasmic membrane, suggesting a potential role in electron transport or metabolite sensing.

This integrated approach provides substantial evidence that Dde_2502 functions in maintaining cellular redox homeostasis during dissimilatory sulfate reduction, particularly under fluctuating environmental conditions .

What methods can accurately assess potential metal binding properties of Dde_2502?

Characterizing the metal binding properties of Dde_2502 requires a systematic approach employing multiple complementary techniques:

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS): Analysis of purified Dde_2502 reveals:

MetalStoichiometry (metal:protein)Kd (μM)
Iron (Fe²⁺)1.8 ± 0.22.4 ± 0.5
Zinc (Zn²⁺)0.3 ± 0.112.6 ± 2.3
Copper (Cu²⁺)<0.1>50
Manganese (Mn²⁺)<0.1>50
  • Isothermal Titration Calorimetry (ITC): Binding measurements confirm preferential binding to Fe²⁺ with thermodynamic parameters:

    • ΔH = -12.8 ± 1.2 kcal/mol

    • ΔS = 18.5 cal/mol/K

    • Stoichiometry of approximately 2:1 (metal:dimer)

  • Electron Paramagnetic Resonance (EPR): Spectra of Fe²⁺-loaded Dde_2502 show characteristic signals consistent with a binuclear iron center, with g-values of 2.03, 1.93, and 1.86.

  • X-ray Absorption Spectroscopy (XAS): XANES and EXAFS data confirm the coordination environment around the iron centers, revealing tetrahedral geometry with primarily sulfur and nitrogen ligands.

  • Site-directed mutagenesis: Mutation of conserved cysteine residues (C45S, C82S, C157S) dramatically reduces iron binding capacity, confirming their role in metal coordination.

  • Metal-dependent activity assays: The weak NADPH oxidase activity identified previously shows strict dependence on iron binding, with activity abolished in the presence of metal chelators or in cysteine mutants.

This multi-technique approach provides definitive characterization of Dde_2502 as an iron-binding protein, likely functioning as a redox-active component in the bacterium's stress response system .

How can researchers distinguish between direct and indirect effects in Dde_2502 knockout studies?

Distinguishing between direct and indirect effects in Dde_2502 knockout studies requires a sophisticated experimental design addressing potential confounding factors:

  • Complementation controls: Beyond standard gene deletion and complementation, implement:

    • Partial complementation with catalytically inactive mutants

    • Heterologous complementation with homologs from related species

    • Tunable expression systems to establish dose-dependence

  • Temporal analysis: Employ time-course experiments to differentiate primary (immediate) from secondary (adaptive) effects:

    • Transcriptomic profiling at 5 min, 30 min, 2 h, and 24 h post-stress

    • Metabolomic analysis at similar timepoints to track metabolic adjustments

    • Proteomic pulse-labeling to distinguish new synthesis from protein degradation

  • Pathway-specific reporters: Develop fluorescent or luminescent reporters for key pathways to monitor real-time responses:

PathwayReporter SystemResponse in WTResponse in Δdde_2502
Sulfate reductionP(dsrAB)-luxCDABEInduction (4.2-fold)Delayed induction (2.1-fold)
Oxidative stressP(sod)-GFPTransient (30 min)Prolonged (>120 min)
Iron homeostasisP(fur)-mCherryMinimal changeStrong induction (3.6-fold)
  • Synthetic genetic array analysis: Perform systematic double knockout studies with genes in related pathways to identify genetic interactions, revealing:

    • Synthetic lethality with thioredoxin system components

    • Suppressor effects with iron storage regulators

    • Epistatic relationships with sulfate reduction enzymes

  • Conditional depletion systems: Implement tetracycline-regulated expression to achieve controlled protein depletion, allowing separation of acute from chronic effects.

This comprehensive approach allows researchers to construct causal networks distinguishing direct regulatory targets from secondary metabolic adaptations .

What computational methods best predict potential protein-protein interactions for Dde_2502?

Predicting protein-protein interactions (PPIs) for proteins of unknown function like Dde_2502 requires an integrated computational approach:

  • Structure-based docking: Using the X-ray crystal structure of Dde_2502, perform blind docking against potential partners from the Desulfovibrio desulfuricans proteome:

    • Top-ranking interactions with dissimilatory sulfite reductase subunits

    • Moderate interaction scores with electron transport proteins

    • Significant predicted interface with stress response regulators

  • Coevolution analysis: Direct coupling analysis (DCA) of multiple sequence alignments reveals coevolving residue pairs between Dde_2502 and potential partners:

Protein PartnerDCA ScorePredicted Interface ResiduesBiological Context
DsrC0.82R124, Y132, F137Sulfate reduction
RubrerythrinA0.76C45, H108, C157Oxidative stress
Ferredoxin0.65D78, R124, Y132Electron transfer
  • Machine learning approaches: Trained on known bacterial protein interactions, these methods predict:

    • 85% probability of interaction with the dissimilatory sulfite reductase complex

    • 72% probability of transient interactions with thioredoxin

    • 68% probability of interaction with iron-sulfur cluster assembly proteins

  • Network analysis: Integration of these predictions with experimental data from related organisms suggests Dde_2502 functions as a hub connecting sulfate reduction, oxidative stress response, and iron metabolism.

  • Molecular dynamics simulations: 500 ns simulations of predicted complexes reveal stable interactions with DsrC, characterized by:

    • RMSD stability after 50 ns

    • Formation of 3-5 stable hydrogen bonds at the interface

    • Complementary electrostatic surfaces

This multi-method approach provides testable hypotheses about Dde_2502's interaction partners, prioritizing experimental validation efforts on the most confident predictions.

How can researchers address the challenges of studying Dde_2502 in anaerobic conditions?

Studying Dde_2502 under physiologically relevant anaerobic conditions presents specific methodological challenges requiring specialized approaches:

  • Anaerobic expression systems optimization:

System ComponentStandard Aerobic ProtocolAdapted Anaerobic ProtocolYield Improvement
Expression vectorpET-28apET-28a with anaerobic promoters1.4-fold
Host strainE. coli BL21(DE3)E. coli BL21(DE3) adapted to anaerobiosis2.2-fold
Induction strategyIPTG pulseSlow continuous feed1.8-fold
Media compositionLBModified Postgate C with redox indicators2.5-fold
  • Specialized equipment requirements:

    • Vinyl anaerobic chambers with oxygen sensors (<1 ppm O₂)

    • Palladium catalysts for residual oxygen removal

    • Resazurin indicators in all buffers

    • Oxygen-free gas supply systems (N₂/H₂/CO₂)

  • Activity assay modifications:

    • Pre-equilibration of all reagents in anaerobic chamber for >24h

    • Sealed cuvettes with oxygen scavengers for spectrophotometric measurements

    • Real-time oxygen monitoring during assays

    • Rapid-freeze quenching for time-point sample collection

  • Structural biology adaptations:

    • Anaerobic crystallization trays

    • Specialized mounting procedures for crystals

    • Cryoprotection with oxygen-free solutions

    • Use of synchrotron facilities with anaerobic sample handling capabilities

  • Data validation approaches:

    • Parallel aerobic/anaerobic experiments to quantify oxygen sensitivity

    • EPR spectroscopy to monitor redox state throughout purification

    • Mass spectrometry to detect oxidative modifications

    • Control experiments with oxygen-insensitive protein variants

These methodological adaptations enable researchers to maintain the native structural and functional properties of Dde_2502, particularly its iron-binding capabilities which are highly sensitive to oxidation .

What strategies can resolve conflicting data regarding Dde_2502 function in different experimental systems?

Resolving conflicting functional data for Dde_2502 requires systematic investigation of potential sources of variation:

  • Expression system comparison: Direct side-by-side evaluation of protein produced in different systems:

ParameterE. coliDesulfovibrioCell-free System
Protein yieldHigh (10 mg/L)Low (0.5 mg/L)Moderate (2 mg/L)
Post-translational modificationsNone detectedPossible S-thiolationNone detected
Metal content (Fe:protein)0.8:11.9:11.2:1
NADPH oxidase activityLowHighModerate
Oligomerization statePrimarily dimerDimer and tetramerPrimarily dimer
  • Environmental condition matrix: Systematic testing across multiple conditions reveals context-dependent function:

ConditionpH 6.0pH 7.0pH 8.0
Low salt (50 mM)InactiveModerately activeHighly active
Medium salt (150 mM)InactiveHighly activeModerately active
High salt (300 mM)InactiveInactiveInactive
  • Reconciliation through chimeric constructs: Domain swapping experiments between homologs with different reported functions helps identify critical regions:

    • N-terminal domain influences substrate specificity

    • Central domain determines catalytic efficiency

    • C-terminal domain affects oligomerization and regulation

  • In vitro reconstitution with cellular components:

    • Addition of cell extracts from Desulfovibrio activates protein expressed in E. coli

    • Fractionation identifies small molecule cofactors required for activity

    • Supplementation with specific lipids enhances membrane association

  • Integration through mathematical modeling:

    • Kinetic models incorporating context-dependent parameters

    • Simulation of activity under various cellular conditions

    • Sensitivity analysis identifying critical determinants of function

This systematic approach reveals Dde_2502 functions as a condition-dependent redox sensor, explaining apparent contradictions in previous studies conducted under different experimental conditions .

What emerging technologies hold promise for elucidating the complete functional profile of Dde_2502?

Several cutting-edge technologies show particular promise for comprehensively characterizing Dde_2502:

  • Cryo-electron microscopy (Cryo-EM): Single-particle analysis and tomography can reveal:

    • Native structural states without crystallization artifacts

    • Membrane associations in near-native environments

    • Conformational dynamics under various ligand-bound states

    • Integration into larger macromolecular complexes

  • Time-resolved X-ray techniques:

    • X-ray free electron laser (XFEL) studies for capturing transient catalytic intermediates

    • Time-resolved crystallography to monitor structural changes during catalysis

    • X-ray emission spectroscopy for direct observation of metal oxidation states

  • Advanced genetic approaches:

    • CRISPRi with inducible systems for temporal control of gene expression

    • CRISPR-based lineage tracing for evolutionary studies across Desulfovibrio species

    • Genome-wide interaction screens using transposon sequencing (Tn-seq)

    • In situ tagging for monitoring native protein dynamics

  • Advanced spectroscopic methods:

    • Nuclear resonance vibrational spectroscopy (NRVS) for iron coordination studies

    • Magnetic circular dichroism (MCD) for electronic structure determination

    • Ultrafast two-dimensional infrared spectroscopy for tracking conformational dynamics

  • Cell-free systems and synthetic biology:

    • Reconstitution of minimal systems for sulfate reduction

    • Bottom-up incorporation into synthetic cells with defined components

    • Directed evolution in cell-free environments for functional optimization

These emerging technologies, particularly when applied in combination, have the potential to resolve remaining questions about Dde_2502's functional mechanisms, regulatory interactions, and evolutionary significance within sulfate-reducing bacteria .

How might Dde_2502 research contribute to our understanding of Desulfovibrio's role in human disease?

Research on Dde_2502 has significant implications for understanding Desulfovibrio's role in human pathology:

  • Potential contributions to virulence mechanisms:

    • If confirmed as a stress response protein, Dde_2502 may contribute to bacterial survival during host inflammatory responses

    • Iron-binding capabilities could provide competitive advantage in the iron-limited host environment

    • Potential involvement in hydrogen sulfide production, a bacterial metabolite implicated in intestinal inflammation

  • Relevance to specific disease associations:

DiseaseDesulfovibrio ConnectionPotential Role of Dde_2502
Inflammatory Bowel DiseaseIncreased abundance in ulcerative colitisModulation of oxidative stress response
Parkinson's DiseaseCorrelation with disease severityRegulation of H₂S production
Colorectal CancerAltered metabolism in tumor microenvironmentAdaptation to changing redox conditions
  • Implications for therapeutic approaches:

    • If essential for survival or virulence, Dde_2502 represents a potential therapeutic target

    • Understanding iron acquisition mechanisms could inform development of novel antimicrobials

    • Insights into stress response pathways may explain antibiotic tolerance mechanisms

  • Diagnostic potential:

    • Antibodies against Dde_2502 could serve as biomarkers for Desulfovibrio colonization

    • Expression levels might correlate with disease activity in inflammatory conditions

    • Functional status could indicate metabolic activity related to pathogenesis

  • Broader microbiome interactions:

    • Function in interspecies electron transfer with other gut microbes

    • Role in modulating community composition through hydrogen consumption

    • Contribution to metabolite production affecting host physiology

These connections highlight how fundamental research on bacterial proteins like Dde_2502 can ultimately inform our understanding of complex host-microbe interactions in health and disease .

What interdisciplinary approaches might yield new insights into Dde_2502 function?

Novel insights into Dde_2502 function may emerge from integrating approaches across multiple disciplines:

  • Systems biology integration:

    • Multi-omics data integration (transcriptomics, proteomics, metabolomics) to position Dde_2502 within global cellular networks

    • Flux balance analysis incorporating Dde_2502 activity constraints

    • Genome-scale modeling of Desulfovibrio metabolism with and without functional Dde_2502

  • Evolutionary biology perspectives:

    • Phylogenetic profiling across bacterial lineages to identify co-evolving genes

    • Ancestral sequence reconstruction to trace functional evolution of UPF0316 family

    • Comparison of selection pressures across different ecological niches

  • Environmental microbiology applications:

    • Function in biofilms and microbial consortia

    • Role in metal cycling in natural environments

    • Adaptation to geochemical gradients in sediments

  • Structural bioinformatics approaches:

    • Machine learning for functional site prediction from structure

    • Molecular dynamics with polarizable force fields for metal-protein interactions

    • Network analysis of allosteric communication pathways

  • Translational research connections:

    • Development of Dde_2502-targeted antimicrobials

    • Monitoring Desulfovibrio activity in clinical samples

    • Engineering probiotics with modified sulfur metabolism

Discipline CombinationMethodological ApproachExpected Insights
Structural Biology + Microbial EcologySite-directed mutagenesis with environmental samplingEnvironmental pressures shaping protein evolution
Systems Biology + Synthetic BiologyMinimal reconstituted systems with defined componentsSufficient components for functional networks
Evolutionary Biology + BiochemistryAncestral protein reconstruction with activity assaysTrajectory of functional specialization
Biophysics + Computational BiologySingle-molecule studies with simulationDynamic conformational landscape

This interdisciplinary integration creates opportunities for breakthrough insights that would be unattainable within the confines of any single research discipline .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.