Recombinant Desulfovibrio magneticus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase in Desulfovibrio magneticus

Desulfovibrio magneticus is a sulfate-reducing δ-proteobacterium renowned for its ability to synthesize intracellular magnetite crystals (magnetosomes) under anaerobic conditions . ATP synthase, a critical enzyme for energy metabolism, facilitates ATP production via oxidative phosphorylation. The subunit a (encoded by atpB) forms part of the membrane-embedded F₀ sector of the F-type ATP synthase complex, which is essential for proton translocation and coupling with the F₁ catalytic domain .

Recombinant Production of D. magneticus ATP Synthase Subunit a

Recombinant D. magneticus ATP synthase subunit a (atpB) is a 238-amino acid protein (UniProt ID: C4XQ07) expressed in Escherichia coli with an N-terminal His tag for purification . Key production details include:

ParameterDescription
Host SystemEscherichia coli
TagN-terminal His tag
Molecular Weight~28 kDa (predicted)
Gene Length1–714 bp (238 residues)
ApplicationStructural studies, enzymatic assays, antibody production

This recombinant protein enables mechanistic studies of ATP synthase function in sulfate-reducing bacteria .

Role in Proton Translocation

Subunit a is integral to the F₀ proton channel, enabling proton flow across the membrane to drive ATP synthesis. In D. magneticus, this process is linked to sulfate respiration, where electron transport generates a proton gradient .

Comparative Genomics

Genomic analyses reveal that D. magneticus shares conserved ATP synthase operons with other magnetotactic bacteria, including nuo (NADH dehydrogenase) and mamAB-like clusters . These clusters are critical for energy metabolism and magnetosome formation .

Magnetosome Biomineralization

The ATP synthase complex in D. magneticus indirectly supports magnetite crystal formation by maintaining cellular energy homeostasis during iron uptake . Genome-editing studies highlight the role of ATP synthase in sustaining metabolic pathways under anaerobic conditions .

Heterologous Expression Systems

The recombinant subunit a serves as a tool for:

  • Investigating F-type ATPase evolution in δ-proteobacteria .

  • Developing inhibitors targeting bacterial energy metabolism .

Key Studies

  1. Proton-Coupled ATP Synthesis

    • D. magneticus generates ATP via a chemiosmotic mechanism, leveraging proton gradients from sulfate respiration .

    • Subunit a mutations disrupt proton channel function, reducing ATP yield .

  2. Genomic Conservation

    • The atpB gene resides within a conserved operon shared with Magnetospirillum species, suggesting horizontal gene transfer .

OrganismConserved Gene ClustersATP Synthase Role
D. magneticusnuo, mamAB-like, plasmid genesMagnetosome formation, sulfate respiration
Magnetospirillum gryphiswaldensemamAB, mms6Magnetite crystal regulation

Challenges and Future Directions

While recombinant subunit a facilitates structural studies, D. magneticus remains challenging to culture aerobically, limiting high-yield protein production . Future work may focus on:

  • Cryo-EM structural resolution of the full ATP synthase complex.

  • Engineering hyperexpression strains for industrial-scale applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; DMR_42160; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Target Names
atpB
Target Protein Sequence
MAGGLPHPVLLVDEAAKSVGLYKLNDVFHAQVIDSNVIYAWFAMVLLIILGTLATRKLAM VPSGLQNFFEVVVGGLESFVVENIGEKGRKVYPFLCALFLFIITGNLIGLVPGLDSPTNN VNTNAAMALTVFAYYNFWGIRMWGAGYIKHFMGPFWWLVPLMLPIEIISHLARPLSLTLR LFGNIRGEEIVLVLLFALAPVVGTFPMYFLFSLADCIQAFVFFMLAMIYLKGSLDHAH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Desulfovibrio magneticus RS-1 and why is it significant for ATP synthase research?

Desulfovibrio magneticus RS-1 is a sulfate-reducing obligate anaerobe classified under the Desulfobacterota phylum. It represents the only isolated magnetotactic bacterium within the δ-proteobacteria class . Unlike more commonly studied α-proteobacterial magnetotactic bacteria, D. magneticus synthesizes irregular tooth-shaped magnetite crystals organized in distinctive subchains along the positive cell curvature . This organism's unique phylogenetic position and specialized adaptations make it valuable for comparative studies of energy metabolism across different bacterial lineages.

The significance of D. magneticus for ATP synthase research stems from its adaptation to anaerobic environments and its position as an evolutionary distinct magnetotactic bacterium. Understanding ATP synthase function in this organism could provide insights into how energy production mechanisms have evolved across bacterial phyla and how they function under the specialized conditions required by magnetotactic bacteria.

How does the AtpB subunit contribute to ATP synthase function in D. magneticus?

The AtpB protein encodes the β subunit of ATP synthase, which plays a central role in the catalytic mechanism of ATP production . In the ATP synthase complex, three β subunits alternate with three α subunits to form the F₁ catalytic hexamer where ATP synthesis occurs. The β subunits contain the nucleotide binding sites that undergo conformational changes during catalysis.

What expression systems are most appropriate for producing recombinant D. magneticus AtpB?

Methodological approach:

  • Consider using anaerobic expression systems or E. coli strains adapted for anaerobic growth

  • Evaluate specialized expression vectors containing D. magneticus-optimized promoters

  • Test expression with various fusion tags (His, GST, MBP) to enhance solubility and facilitate purification

  • Implement cold-shock expression protocols to slow protein synthesis and improve folding

  • Consider cell-free expression systems for difficult-to-express proteins

Based on results with other ATP synthase subunits, co-expression with chaperones may significantly improve the yield of properly folded protein. Expression levels for recombinant AtpB should be monitored carefully, as even low levels (approximately 5% of native levels) have shown functionality in complementation studies with other ATP synthase subunits .

How can recombinant D. magneticus AtpB be used to investigate magnetosome formation?

Magnetotactic bacteria synthesize intracellular magnetite particles (magnetosomes) through a complex process involving iron accumulation from the environment . While the direct relationship between ATP synthase and magnetosome formation remains unclear, recombinant AtpB can serve as a valuable tool for investigating potential connections through several methodological approaches:

Experimental strategy:

  • Generate AtpB deletion mutants in D. magneticus using gene editing techniques similar to those established for other magnetotactic bacteria

  • Complement these mutants with recombinant wild-type or modified AtpB to assess functional recovery

  • Employ fluorescently-tagged recombinant AtpB to visualize its localization relative to magnetosome chains

  • Use proximity labeling techniques with recombinant AtpB to identify protein interaction partners

  • Analyze ATP production capabilities in relation to magnetosome formation stages

Research has shown that in D. magneticus RS-1, magnetic particles initially form randomly within the cell before localizing to regions of positive cell curvature . Investigating whether ATP synthesis rates correlate with specific stages of magnetosome formation could reveal important energetic requirements for this process. Additionally, determining if ATP synthase complexes show any spatial relationship to magnetosome chains would provide insights into the cellular organization of these bacteria.

What structural adaptations might D. magneticus AtpB exhibit compared to counterparts in other bacteria?

D. magneticus exists in specialized anaerobic, iron-rich environments and possesses unique cellular features like cristae-like intracytoplasmic membranes (ICMs) . These environmental and structural adaptations likely influence the molecular characteristics of its ATP synthase components.

Comparative structural analysis methodology:

  • Perform sequence alignment of AtpB from D. magneticus against homologs from:

    • Other magnetotactic bacteria (α-proteobacteria)

    • Non-magnetotactic δ-proteobacteria

    • Model organisms like E. coli

  • Identify conserved catalytic residues versus variable regions

  • Model the three-dimensional structure using homology modeling and molecular dynamics simulations

  • Express recombinant wild-type and chimeric AtpB variants for functional analysis

  • Employ hydrogen-deuterium exchange mass spectrometry to identify regions with altered stability

The structural comparison should focus particularly on regions involved in:

  • Nucleotide binding and catalysis

  • Subunit-subunit interactions within the F₁ complex

  • Interactions with membrane components

  • Potential adaptations to anaerobic environment

Evidence from studies of nuclear-encoded ATP synthase subunits suggests that even when recombinant ATP synthase subunits accumulate at only ~5% of wild-type levels, they can restore significant functionality . This indicates potential structural flexibility that allows incorporation into existing complexes.

What experimental designs are most effective for analyzing ATP synthase assembly with recombinant AtpB?

Investigating ATP synthase assembly requires carefully designed experiments that can track the incorporation of recombinant AtpB into functional complexes. Based on complementation studies in other systems, several approaches can be implemented:

Comprehensive experimental design:

  • Generate a conditional AtpB knockout strain of D. magneticus

  • Complement with epitope-tagged recombinant AtpB expressed at controlled levels

  • Isolate membrane fractions at different time points after induction

  • Analyze complex assembly using:

    • Blue Native PAGE to visualize intact ATP synthase complexes

    • Sucrose gradient ultracentrifugation for complex separation

    • Co-immunoprecipitation with antibodies against other ATP synthase subunits

    • Cryo-electron microscopy of purified complexes

Research with chloroplast ATP synthase has shown that recombinant AtpB can rescue function even when accumulating at significantly lower levels (~5%) than native protein . This suggests a potential experimental design using dilution series of recombinant protein to determine the minimal threshold for functional complex formation.

TechniqueApplicationExpected Outcome
Blue Native PAGEVisualization of intact complexesDetection of assembled ATP synthase with incorporated recombinant AtpB
Co-immunoprecipitationProtein-protein interactionIdentification of assembly intermediates and interaction partners
ATP synthesis assaysFunctional analysisQuantification of enzymatic activity correlated with AtpB incorporation
Fluorescence microscopyLocalization studiesVisualization of recombinant AtpB distribution relative to cellular structures
Thermal shift assaysComplex stabilityDetermination of stability differences between native and recombinant complexes

How can site-directed mutagenesis of recombinant D. magneticus AtpB provide insights into its functional mechanisms?

Site-directed mutagenesis of recombinant AtpB provides a powerful approach to interrogate structure-function relationships within the ATP synthase complex. The methodological approach should include:

  • Identification of target residues based on:

    • Sequence conservation analysis across species

    • Structural models highlighting catalytic sites

    • Regions unique to D. magneticus compared to other bacteria

    • Residues potentially involved in adaptation to anaerobic conditions

  • Generation of mutant libraries including:

    • Catalytic site mutations affecting nucleotide binding and hydrolysis

    • Interface mutations affecting interactions with other subunits

    • Mutations in regions potentially involved in proton translocation coupling

  • Functional characterization through:

    • Complementation assays in AtpB-deficient strains

    • ATP synthesis/hydrolysis assays with purified mutant proteins

    • Structural analysis of mutant complexes

    • Thermal stability measurements of mutant complexes

Comparable studies with maize chloroplast ATP synthase demonstrated that nuclear-encoded AtpB can integrate into the ATP synthase complex and restore significant photosynthetic function (15-30% of wild-type levels for Fv/Fm parameters) . This suggests that even with potential structural differences, recombinant proteins can maintain core functionality, providing a foundation for mutational analysis.

What are the optimal conditions for purifying active recombinant D. magneticus AtpB?

Purification of active recombinant AtpB requires careful consideration of the protein's structural requirements and native environment. Based on known properties of ATP synthase subunits and the anaerobic nature of D. magneticus, the following methodological approach is recommended:

Purification protocol optimization:

  • Expression conditions:

    • Anaerobic or microaerobic expression systems

    • Low temperature induction (16-20°C) to improve folding

    • Rich media supplemented with iron sources

  • Cell lysis:

    • Gentle lysis methods (osmotic shock or enzymatic treatment)

    • Inclusion of protease inhibitors and reducing agents

    • Maintenance of anaerobic conditions when possible

  • Purification steps:

    • Initial capture using affinity chromatography (His-tag or other fusion tags)

    • Ion exchange chromatography for removing contaminants

    • Size exclusion chromatography for final polishing and buffer exchange

  • Buffer optimization:

    • Inclusion of stabilizing agents (glycerol, specific lipids)

    • Reducing environment (DTT or β-mercaptoethanol)

    • pH optimization based on D. magneticus cytoplasmic pH

  • Activity preservation:

    • Addition of ATP or non-hydrolyzable analogs during purification

    • Inclusion of specific lipids that maintain protein structure

    • Storage in small aliquots at -80°C with cryoprotectants

The purification strategy should be validated through activity assays comparing the recombinant protein to native ATP synthase complexes isolated from D. magneticus.

What reporter systems can be used to track expression and function of recombinant D. magneticus AtpB?

Effective tracking of recombinant AtpB expression and function requires carefully selected reporter systems that minimize interference with protein function while providing reliable detection. Based on successful approaches with other ATP synthase subunits, the following methodologies are recommended:

Reporter system selection:

  • Epitope tags for detection and purification:

    • Small epitope tags (HA, FLAG, His) at the C-terminus typically minimize functional interference

    • HiBit or similar luciferase-based detection systems for quantitative analysis

    • Split fluorescent protein tags for in vivo localization studies

  • Functional reporters:

    • ATP synthesis assays using luminescent ATP detection

    • Membrane potential sensors to assess proton-motive force utilization

    • Growth complementation in AtpB-deficient strains

  • Structural integration reporters:

    • FRET-based reporters to assess subunit interactions

    • Crosslinking approaches to verify complex assembly

    • Protease protection assays to confirm proper folding and assembly

Research with recombinant AtpB in other systems has successfully employed HA-epitope tags for detection via protein blot analysis, demonstrating that tagged proteins can be distinguished from endogenous proteins by mobility differences in gel electrophoresis . Additionally, quantification relative to wild-type protein has been achieved through dilution series and immunoblotting .

How can dilution-replicate experimental designs improve quantitative analysis of recombinant AtpB expression?

Traditional qPCR and protein quantification approaches often rely on identical technical replicates, which may not optimize experimental efficiency. A dilution-replicate design offers advantages for quantifying recombinant AtpB expression:

Dilution-replicate methodology:

  • Instead of performing identical replicates at a single concentration, perform single reactions across a series of dilutions for each sample

  • Apply this approach to both qPCR (for transcript quantification) and protein analysis (for expression level assessment)

  • For qPCR, use a globally estimated PCR efficiency (E) constrained across all samples

  • For protein quantification, create standard curves from serial dilutions of purified recombinant AtpB

This approach offers several advantages:

  • Provides more data points across a concentration range with the same number of reactions

  • Enables more accurate determination of quantification limits

  • Allows for better assessment of inhibitory effects in complex samples

  • Facilitates direct comparison between samples by establishing linearity across dilutions

When applied to recombinant AtpB quantification, this method has helped determine that functional complementation can occur even when recombinant protein accumulates at only ~5% of wild-type levels , providing important context for expression optimization efforts.

How can recombinant D. magneticus AtpB be used to investigate evolutionary relationships among magnetotactic bacteria?

Magnetotactic bacteria span several bacterial phyla with diverse phenotypes, though mechanistic studies have focused primarily on two species of Alphaproteobacteria . Recombinant AtpB provides a valuable tool for comparative evolutionary studies:

Evolutionary analysis methodology:

  • Sequence and structural comparison:

    • Align AtpB sequences from magnetotactic bacteria across different phyla

    • Identify conserved domains versus lineage-specific adaptations

    • Reconstruct phylogenetic relationships based on ATP synthase components

    • Compare against phylogenies based on other magnetosome-related proteins

  • Functional analysis:

    • Express recombinant AtpB from multiple magnetotactic species in a common host

    • Assess functional parameters (ATP synthesis rates, proton translocation efficiency)

    • Evaluate cross-complementation between species

    • Create chimeric proteins to identify functionally critical regions

  • Co-evolution analysis:

    • Compare evolutionary rates of AtpB with those of magnetosome formation proteins

    • Identify potential co-adaptation patterns between energy production and magnetosome synthesis

    • Assess horizontal gene transfer events that may have influenced ATP synthase evolution

This approach can help determine whether biomineralization mechanisms originated from a common ancestor while magnetosome chain formation diverged evolutionarily among different MTB lineages .

What insights can heterologous expression of D. magneticus AtpB provide about ATP synthase assembly and function?

Heterologous expression of D. magneticus AtpB in non-native hosts can reveal fundamental principles of ATP synthase assembly, tolerance for subunit variation, and functional conservation:

Heterologous expression experimental design:

  • Express D. magneticus AtpB in:

    • E. coli or other model bacteria with ATP synthase deletions

    • Other magnetotactic bacteria from different phylogenetic groups

    • Eukaryotic systems (yeast, insect cells) with modified mitochondrial targeting

  • Assessment parameters:

    • Complex assembly efficiency

    • ATP synthesis rates

    • Growth complementation

    • Proton transport coupling efficiency

    • Tolerance to environmental stressors

  • Structural analysis:

    • Cryo-EM of hybrid complexes

    • Crosslinking and mass spectrometry to identify interacting regions

    • Hydrogen-deuterium exchange to assess structural stability

Studies with nuclear-encoded ATP synthase subunits have demonstrated that even when heterologously expressed proteins accumulate at only ~5% of wild-type levels, they can restore significant functionality in complementation assays . This suggests considerable flexibility in ATP synthase assembly mechanisms and provides a foundation for heterologous expression studies with D. magneticus AtpB.

How might the study of recombinant D. magneticus AtpB contribute to understanding cristae-like structures in bacteria?

Recent research has identified cristae-like microcompartments in Desulfobacterota, including structures similar to those in mitochondria . These findings suggest potential evolutionary relationships between bacterial and mitochondrial membrane organizations. Recombinant AtpB can serve as a tool for investigating these structures:

Experimental approach:

  • Express fluorescently tagged recombinant AtpB to visualize its localization relative to cristae-like structures

  • Perform immuno-electron microscopy to determine precise localization at ultrastructural level

  • Analyze the role of ATP synthase dimers in cristae formation by introducing mutations that affect dimerization

  • Compare lipid compositions of ATP synthase-rich membrane regions

Since MICOS proteins, ATP synthase dimers, and cardiolipin are necessary for cristae formation , manipulating ATP synthase through recombinant AtpB expression could help elucidate the evolutionary origins of these structures. ATP synthase dimers are known to influence membrane curvature in mitochondria, and similar mechanisms may operate in these bacterial systems.

What biosafety and regulatory considerations apply to research with recombinant D. magneticus proteins?

Research involving recombinant DNA from D. magneticus falls under established biosafety frameworks, but requires specific considerations:

Regulatory framework:

  • Institutional Biosafety Committee (IBC) review:

    • D. magneticus is classified as Biosafety Level 1 (BSL-1) as a non-pathogenic organism

    • Recombinant DNA work typically requires IBC approval and adherence to NIH Guidelines

    • Specific considerations may apply for gene transfer using viral vectors

  • Risk assessment factors:

    • Expression systems (E. coli vs. other hosts)

    • Scale of production

    • Potential for gene transfer to environmental organisms

    • Creation of novel function through protein engineering

  • Methodological safeguards:

    • Physical containment appropriate to the expression system

    • Biological containment through use of attenuated host strains

    • Documentation of experimental procedures and risk mitigation strategies

The NIH Recombinant DNA Advisory Committee (RAC) provides guidance on recombinant DNA research, though case-by-case review is typically limited to novel applications representing significant departures from familiar practices .

How should researchers approach experimental design to maximize data quality while minimizing resource use?

Efficient experimental design is essential for rigorous scientific investigation while conserving research resources:

Optimized experimental approach:

  • Implementation of dilution-replicate designs rather than identical replicates:

    • Perform single reactions across multiple dilutions instead of multiple identical replicates

    • This approach requires fewer sample reactions while providing more comprehensive data

  • Global estimation of parameters:

    • When appropriate, constrain parameters across multiple experiments

    • For qPCR, estimate PCR efficiency (E) globally across all samples rather than individually

  • Integrated experimental planning:

    • Design experiments to address multiple hypotheses simultaneously

    • Incorporate controls that serve multiple analytical purposes

    • Archive samples appropriately for potential follow-up studies

  • Statistical power analysis:

    • Determine appropriate sample sizes based on expected effect magnitudes

    • Use statistical methods that maximize information extraction from limited datasets

This approach not only conserves resources but can provide more robust data by examining responses across concentration ranges rather than at single points.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.