Recombinant Desulfovibrio salexigens Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Substrate Binding and Cleavage

  • Lipobox Recognition: The β-cradle and PH clamp the substrate, positioning the scissile bond (Gly-Cys*) adjacent to the catalytic dyad .

  • Conformational Dynamics: Molecular dynamics (MD) simulations reveal PH fluctuations between closed (occluding active site) and open (substrate-accessible) states. Antibiotics like globomycin stabilize intermediate conformations, blocking substrate entry .

Antibiotic Inhibition

Globomycin and myxovirescin are natural inhibitors that mimic the lipobox sequence. Key findings:

InhibitorMechanismEffectivenessSource
GlobomycinSteric blockage of active site; mimics g.Leu-g.Ile-g.Ser sequence.Inhibits P. aeruginosa and S. aureus LspA.
MyxovirescinBinds opposing side of substrate-binding pocket compared to globomycin.Synergistic inhibition potential.

Role in Desulfovibrio Pathophysiology

While Desulfovibrio salexigens LspA data are unavailable, related Desulfovibrio species (e.g., D. alaskensis, D. vulgaris) highlight its importance:

  • Sulfate Reduction: LspA processes lipoproteins critical for electron transport chains in sulfate-reducing bacteria (SRB), including those involved in hydrogen sulfide (H₂S) production .

  • Biofilm Formation: SRB biofilms exhibit altered LspA-dependent lipoprotein profiles, linking LspA to stress response and metabolic adaptation .

Unaddressed Questions

  • Species-Specific Variations: Structural differences in Desulfovibrio LspA (e.g., lipid A composition, LPS interactions) remain unexplored .

  • Antibiotic Resistance: Potential resistance mutations in conserved residues (e.g., Asp-110, Asp-214) require investigation .

Therapeutic Potential

  • Broad-Spectrum Targets: LspA’s essential role in Gram-negative bacteria makes it a candidate for antibiotics. Globomycin derivatives are under development .

  • SRB-Specific Inhibition: Targeting LspA in Desulfovibrio could mitigate H₂S-related pathologies (e.g., inflammatory bowel disease, Parkinson’s disease) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Desal_2005; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)
Target Names
lspA
Target Protein Sequence
MNKYFLAGIISVVTLVLDQVTKIAVREKMVLWTSETVIPGFFNLVHVVNKGAAFGFLNRA DITWQRNFFVVVTIIALGAIGMLLKSAEEKDKFQILGLGFVLGGAIGNLIDRILYHQVTD FLDFYYGSHHYPAFNVADIAICLGAFAMIVSFYKNK
Uniprot No.

Target Background

Function
This protein is specifically designed to catalyze the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its specific role in Desulfovibrio salexigens?

LspA (Lipoprotein signal peptidase) is a type II signal peptidase (SPase II) that plays a crucial role in bacterial lipoprotein processing. In Desulfovibrio salexigens, as in other gram-negative bacteria, LspA functions as an aspartyl protease that specifically cleaves the transmembrane helix signal peptide of lipoproteins after they have been modified by prolipoprotein diacylglyceryl transferase (Lgt) . This processing is essential for proper lipoprotein localization and function.

The importance of LspA in bacterial physiology is underscored by the fact that it is essential in gram-negative bacteria and significant for virulence in gram-positive bacteria . In D. salexigens, a sulfate-reducing bacterium, properly processed lipoproteins likely play important roles in various cellular processes including nutrient acquisition, cell envelope maintenance, and potentially environmental adaptation mechanisms related to its sulfate-reducing metabolism.

How does the structure of D. salexigens LspA compare with LspA proteins from other bacterial species?

While the specific structure of D. salexigens LspA has not been directly determined, comparative analysis with other bacterial LspA proteins reveals several likely structural features:

The enzyme contains a catalytic dyad and approximately 14 highly conserved residues that surround the active site . These residues create a specific environment for substrate binding and catalysis. The protein likely features multiple transmembrane segments with a characteristic periplasmic helix (PH) that plays a critical role in substrate recognition and binding.

Based on structures of LspA from Pseudomonas aeruginosa (LspPae) and Staphylococcus aureus (LspMrs), D. salexigens LspA likely employs a "clamping" mechanism where the β-cradle and periplasmic helix positions the substrate for cleavage . This structural arrangement explains how LspA accommodates various lipoprotein substrates.

Furthermore, D. salexigens LspA likely exhibits conformational dynamics similar to those observed in other LspA proteins, where the periplasmic helix fluctuates on the nanosecond timescale between closed, intermediate, and open conformations that are essential for enzyme function .

What are the optimal expression systems for producing recombinant D. salexigens LspA?

Producing recombinant D. salexigens LspA presents several challenges due to its nature as a membrane protein. Based on successful approaches with other bacterial LspA proteins, these methodological strategies are recommended:

E. coli-based expression systems have been successful for other bacterial LspA proteins, as demonstrated with Rickettsia typhi LspA . For membrane proteins like LspA, specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21) typically yield better results than standard strains.

Expression vectors with tightly controlled inducible promoters are preferable, as membrane protein overexpression can be toxic to host cells. Low-temperature induction (16-20°C) with reduced inducer concentrations often improves proper folding and membrane insertion.

Critically, functionality must be verified through complementation assays in LspA-deficient or temperature-sensitive E. coli strains. For instance, recombinant LspA from R. typhi has been shown to restore growth in temperature-sensitive E. coli Y815 at non-permissive temperatures . Similar complementation approaches would be valuable for validating D. salexigens LspA expression.

Additionally, globomycin resistance assays provide another functional validation approach, as increased resistance indicates properly folded and functional LspA .

What purification strategies overcome the challenges associated with membrane-embedded D. salexigens LspA?

Purifying recombinant D. salexigens LspA requires specialized approaches to maintain protein stability and activity throughout the process:

StageKey TechniquesCritical Considerations
Membrane isolationDifferential ultracentrifugationBuffer composition, mechanical disruption method
SolubilizationDetergent screening (DDM, LMNG, DM)Detergent:protein ratio, solubilization efficiency
Affinity purificationIMAC for His-tagged constructsDetergent in all buffers, imidazole gradient optimization
Size exclusionSEC for monodispersity assessmentAggregate removal, oligomeric state verification
Quality controlActivity assays, thermal stabilityVerification of proper folding and function

Throughout purification, it's essential to maintain conditions that preserve the native conformation of LspA, including appropriate pH (typically 7.0-8.0), salt concentration (150-300 mM NaCl), and addition of stabilizing agents such as glycerol (10-20%).

For structural studies, reconstitution into membrane mimetics should be considered, including nanodiscs, amphipols, or lipid cubic phase, depending on the intended analytical technique . These approaches better maintain the native-like environment necessary for proper LspA folding and function.

What combined methodological approaches best reveal the conformational dynamics of D. salexigens LspA?

Understanding the conformational dynamics of LspA requires a multi-technique approach, as each method provides complementary information:

Molecular Dynamics (MD) simulations in explicit membrane environments have successfully revealed that the periplasmic helix of LspA fluctuates on the nanosecond timescale and samples unique conformations in different states . These simulations can identify potential conformational states that may not be captured in static structural studies.

Electron Paramagnetic Resonance (EPR) spectroscopy, particularly site-directed spin labeling coupled with continuous wave (CW) EPR and Double Electron-Electron Resonance (DEER), provides experimental validation of the conformational dynamics predicted by MD simulations . This approach has been successfully used to understand conformational changes in LspA upon antibiotic binding.

A hybrid experimental approach combining MD with EPR has proven particularly valuable for identifying protein conformations not observed in crystal structures alone . This combined methodology revealed that LspA samples multiple conformations (closed, intermediate, and open) in various states (apo, inhibitor-bound), with different populations in each state.

For D. salexigens LspA specifically, strategic placement of spin labels should target the periplasmic helix and β-cradle regions that are predicted to undergo conformational changes during substrate binding and catalysis, based on homology with other LspA proteins .

How can researchers quantitatively assess the enzymatic activity of recombinant D. salexigens LspA?

Developing reliable activity assays for LspA requires addressing its membrane-embedded nature and specific substrate requirements:

Synthetic peptide-based assays using fluorogenic peptide substrates designed from D. salexigens lipoprotein signal sequences provide a direct measure of proteolytic activity. These substrates can incorporate FRET pairs or quenched fluorophores that produce measurable signals upon cleavage. Optimization of detergent conditions is crucial to maintain enzyme activity while allowing substrate access.

Complementation assays in LspA-deficient bacteria offer a functional validation approach. For example, temperature-sensitive E. coli LspA mutant strains (e.g., Y815) can be transformed with recombinant D. salexigens lspA to assess growth rescue at non-permissive temperatures. This approach has been successful with R. typhi LspA and provides evidence of physiological function .

Globomycin inhibition assays can confirm proper folding and function. Measuring LspA activity in the presence of increasing concentrations of the specific inhibitor globomycin allows determination of IC50 values and confirms the protein is correctly folded. Additionally, expression of LspA can confer increased globomycin resistance in vivo, providing another functional test .

For all enzymatic assays, researchers must optimize conditions including detergent type and concentration, pH, temperature, and potential cofactors to maximize activity while maintaining stability.

What evidence supports D. salexigens LspA as a viable antimicrobial target, and how does this compare to LspA from other bacterial species?

Multiple lines of evidence support targeting bacterial LspA proteins for antimicrobial development, with implications for D. salexigens LspA:

LspA is essential in gram-negative bacteria, making it an excellent target for antibiotic development . In Desulfovibrio species, which are opportunistic pathobionts that may overgrow in various diseases, targeting LspA could prevent colonization and pathology . Desulfovibrio species represent approximately 66% of all colonic sulfate-reducing bacteria and are increasingly recognized for their potential role in human diseases .

The extensive conservation of active site residues means that resistance mutations that impede antibiotic binding would likely also interfere with the binding and cleavage of substrate . This high functional constraint creates a significant barrier to resistance development, addressing a major concern in antibiotic development.

Existing antibiotics such as globomycin and myxovirescin have demonstrated effectiveness against LspA in various bacteria, with structures of LspA from P. aeruginosa and S. aureus bound to these compounds providing templates for rational drug design . Overexpression of rickettsial LspA in E. coli confers increased globomycin resistance, confirming the mechanistic interaction .

The unique mechanism of LspA involving conformational dynamics of the periplasmic helix offers opportunities for innovative inhibitor design targeting specific conformational states . These dynamics appear conserved across bacterial species and likely apply to D. salexigens LspA as well.

How do the conformational dynamics of LspA influence inhibitor binding, and what implications does this have for rational drug design?

Understanding the conformational dynamics of LspA provides crucial insights for developing effective inhibitors:

LspA exhibits at least three distinct conformational states: closed, intermediate, and open . In the apo state, the dominant conformation is the most closed, occluding the charged active site from the lipid bilayer. With antibiotic bound, the dominant conformation of the periplasmic helix is in a more open, intermediate position .

The different conformations observed in both bound and apo states indicate a flexible and adaptable active site, which explains how LspA accommodates and processes such a variety of substrates . This conformational flexibility also explains the multiple binding modes observed with inhibitors like globomycin.

For rational drug design targeting D. salexigens LspA, compounds that stabilize non-functional conformations would be most effective. Specifically, molecules that lock the enzyme in the intermediate conformation (as globomycin does) would prevent both substrate binding and catalysis .

The catalytic dyad and approximately 14 additional highly conserved residues that surround the active site provide specific interaction points for inhibitor design . The high conservation of these residues across bacterial species suggests that inhibitors developed against model LspA proteins would likely be effective against D. salexigens LspA as well.

How do genomic and functional analyses of D. salexigens LspA inform our understanding of bacterial evolution and adaptation?

Comparative analysis of D. salexigens LspA with orthologs from diverse bacterial species provides evolutionary insights:

The lspA gene shows significant conservation of critical catalytic residues and domains across phylogenetically distant bacterial species . This conservation highlights the fundamental importance of lipoprotein processing across bacterial lineages and suggests strong selective pressure against mutations in the active site.

As a member of the Desulfovibrio genus, D. salexigens has evolved specialized metabolic capabilities for sulfate reduction . The lipoproteins processed by LspA likely play important roles in this specialized metabolism, potentially including sulfate transport, electron transfer, or other functions specific to anaerobic respiration using sulfate as an electron acceptor.

The expression pattern of lipoprotein processing genes may reflect ecological adaptations. In Rickettsia typhi, the transcription of lspA, lgt (encoding prolipoprotein transferase), and lepB (encoding type I signal peptidase) reveals a differential expression pattern during various stages of intracellular growth . Similar regulatory patterns might exist in D. salexigens in response to environmental conditions such as sulfate availability or redox state.

The functional conservation of LspA across diverse bacteria is demonstrated by the ability of recombinant LspA from one species to complement deficiencies in another species, as shown with R. typhi LspA in E. coli . This suggests that despite millions of years of evolutionary divergence, the fundamental mechanism of LspA has remained largely unchanged.

What structural and functional adaptations might distinguish D. salexigens LspA from LspA in non-sulfate-reducing bacteria?

While the core catalytic mechanism of LspA is likely conserved across bacterial species, D. salexigens LspA may exhibit specific adaptations related to its ecological niche:

Substrate specificity adaptations might allow D. salexigens LspA to efficiently process lipoproteins involved in sulfate reduction pathways. These could include subtle changes in the substrate binding pocket to accommodate specific signal peptide sequences common in sulfate reducer lipoproteins.

Membrane environment adaptations may be present, as Desulfovibrio species have distinct membrane compositions that reflect their anaerobic lifestyle . The transmembrane domains of D. salexigens LspA might show specific amino acid compositions that facilitate optimal function in these unique membranes.

Regulatory adaptations could enable differential expression or activity of LspA in response to environmental conditions relevant to sulfate reducers, such as sulfate availability, hydrogen levels, or presence of specific electron donors.

Resistance to inhibition might differ between D. salexigens LspA and orthologs from other bacteria. For example, the sensitivity to globomycin or other LspA inhibitors could vary based on subtle structural differences in the binding pocket or conformational dynamics.

Comparative analysis with well-studied LspA proteins, such as those from P. aeruginosa and S. aureus, could reveal these adaptations through focused mutagenesis studies and substrate preference analyses.

What experimental design approaches can address the challenges of studying conformational changes in D. salexigens LspA?

Investigating the conformational dynamics of membrane proteins like D. salexigens LspA requires sophisticated experimental designs:

Strategic site-directed mutagenesis can introduce reporter groups at key positions predicted to undergo conformational changes. Based on homology models with other LspA proteins, prime targets would include residues in the periplasmic helix and β-cradle regions that form the substrate binding "clamp" .

A combined computational-experimental approach has proven particularly effective for LspA proteins . This involves:

  • Initial homology modeling based on known LspA structures

  • Molecular dynamics simulations to predict conformational states

  • Experimental validation using techniques like EPR spectroscopy

  • Refinement of models based on experimental data

  • Additional simulations to explore conformational transitions

Trap specific conformational states using carefully designed inhibitors or substrate analogs. For example, globomycin stabilizes an intermediate conformation of LspA that inhibits both signal peptide cleavage and substrate binding . Similar approaches with various ligands can help capture different states for structural analysis.

Temperature-dependent studies can provide insights into the energetics of conformational changes. By performing functional and structural analyses at different temperatures, researchers can determine activation energies for conformational transitions and identify potential rate-limiting steps in the catalytic cycle.

Time-resolved experiments, where possible, can capture transient conformational states during catalysis. This might involve rapid mixing techniques coupled with spectroscopic measurements or time-resolved structural methods.

What are the most common technical pitfalls when working with recombinant D. salexigens LspA, and how can researchers overcome them?

Working with membrane proteins like D. salexigens LspA presents numerous technical challenges that require systematic troubleshooting:

ChallengeDiagnostic SignSolution Strategy
Expression toxicityGrowth inhibition after inductionUse tightly controlled expression systems, lower temperatures (16-20°C), reduce inducer concentration
Improper membrane insertionInclusion body formationCo-express with chaperones, optimize signal sequences, include specific lipids in growth media
Protein aggregation during purificationElution in void volume during SECScreen different detergents, optimize detergent:protein ratios, add stabilizing agents
Loss of activity during purificationReduced enzymatic activityVerify proper folding by CD spectroscopy, maintain cold chain, include stabilizing lipids
Poor crystallizationNo crystal formation or poor diffractionTry lipidic cubic phase, use crystallization chaperones, consider surface engineering
Complex EPR spectraDifficult distance measurementsOptimize spin label positions, employ pulsed EPR methods, compare with MD simulations

For D. salexigens proteins specifically, additional considerations include:

  • Growth under microaerobic or anaerobic conditions may better mimic the native environment

  • Addition of sulfate to growth media might improve expression

  • Inclusion of specific lipids common in Desulfovibrio membranes could enhance stability

  • Verification that E. coli expression machinery recognizes D. salexigens signal sequences

A systematic optimization approach is essential, where multiple conditions are tested in parallel and clear success criteria are established for each experimental stage. This might involve factorial experimental designs to efficiently explore the parameter space of expression and purification conditions.

How are recent methodological advances enhancing our understanding of bacterial LspA proteins, and what implications do these have for D. salexigens research?

Recent technological advances have significantly expanded our ability to study membrane proteins like LspA:

The hybrid approach combining molecular dynamics simulations with EPR spectroscopy has revealed conformational dynamics of LspA not observed in crystal structures alone . This methodology identified three distinct conformational states (closed, intermediate, and open) that are essential for understanding LspA function and inhibition.

Advanced cryo-electron microscopy techniques have improved resolution for membrane protein structures, potentially allowing future studies to capture D. salexigens LspA in various conformational states without the need for crystallization.

Membrane mimetic systems including nanodiscs, styrene-maleic acid lipid particles (SMALPs), and native nanodiscs have enhanced our ability to study membrane proteins in near-native environments. These approaches preserve the lipid environment critical for proper LspA function and conformational dynamics.

Time-resolved structural techniques are beginning to capture enzyme dynamics during catalysis, which could reveal transient states in the LspA catalytic cycle that are potential targets for inhibitor design.

For D. salexigens LspA specifically, these methodological advances offer opportunities to understand its function in the context of sulfate-reducing bacterial physiology and potentially develop selective inhibitors targeting this enzyme in pathogenic Desulfovibrio species.

What are the emerging research questions regarding D. salexigens LspA that remain to be addressed in future studies?

Several critical questions about D. salexigens LspA remain unanswered and represent important areas for future research:

The specific lipoprotein substrates processed by D. salexigens LspA have not been fully characterized. Proteomic analyses comparing wild-type and LspA-deficient strains could identify these substrates and elucidate their functions in sulfate reduction pathways and other cellular processes.

The precise contribution of LspA to Desulfovibrio virulence and pathogenicity remains unclear. As Desulfovibrio species are increasingly recognized for their potential role in human diseases , understanding how LspA contributes to their pathogenic potential could inform therapeutic strategies.

The regulation of lspA expression in D. salexigens under different environmental conditions is largely unknown. Studies examining expression patterns in response to factors like oxygen, sulfate availability, and host factors would provide insights into the role of LspA in environmental adaptation.

The potential for developing selective inhibitors targeting D. salexigens LspA while sparing beneficial bacteria remains to be explored. Structural differences between LspA from different bacterial species might allow for the design of species-selective inhibitors.

The evolutionary history of LspA in sulfate-reducing bacteria compared to other bacterial lineages could reveal adaptive changes associated with the specialized lifestyle of Desulfovibrio species. Phylogenetic analyses coupled with structural comparisons could identify these adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.