The recombinant Desulfovibrio salexigens Na⁺-translocating NADH-quinone reductase subunit E (NqrE) is a genetically engineered protein derived from the sulfate-reducing bacterium Desulfovibrio salexigens. It constitutes a critical subunit of the Na⁺-translocating NADH-quinone oxidoreductase (Na⁺-NQR) complex, a membrane-bound enzyme that couples NADH oxidation to sodium translocation, generating a protonmotive force for ATP synthesis . This recombinant version is expressed in E. coli and retains structural and functional features essential for biochemical studies.
The recombinant NqrE contains the following partial sequence:
MEHLVNIFVKSIFIENLALAFFLGMCTYLAVSKKVQTSMGLGVAVIVVMTITVPVNNLLY NYFLREGALAWAGFGDTDLTFVGLISYIGVIAAIVQILEMTLDKYVPSLYNALGIFLPLI TVNCAILGASLFMVERDYNFVESVTFGFGSGVGWALAIVLLAGIREKMKYSDVPEGLDGL GITFIVVGLMSFGFLSFSGIQM .
The Na⁺-NQR complex is a six-subunit (A–F) enzyme that oxidizes NADH and reduces quinones while translocating Na⁺ ions across the membrane. Subunit E (NqrE) is integral to the complex’s structural integrity and catalytic activity:
Sodium Translocation: The complex generates a Na⁺ gradient, critical for ATP synthesis in bacteria lacking proton-pumping systems .
Quinone Interaction: NqrE may interact with quinones, as the Na⁺-NQR complex binds ubiquinone during catalysis .
Electron Transfer: While subunit F (NqrF) harbors the FAD and Fe-S cluster for NADH oxidation , NqrE likely stabilizes subunit interactions or facilitates electron transfer between subunits.
Length variation (198–202 aa) suggests species-specific structural adaptations.
His-tagging facilitates purification via affinity chromatography .
Sodium-Dependent Activity: The Na⁺-NQR complex exhibits a 5-fold stimulation in NADH oxidation by Na⁺, confirming its role as a primary sodium pump .
Quinone Binding: Purification with dodecyl maltoside retains bound ubiquinone, while LDAO removes it, affecting catalytic efficiency .
While the Na⁺-NQR complex is not directly involved in sulfate reduction, its role in energy conservation supports metabolically demanding processes like sulfite reduction. In Desulfovibrio vulgaris, the QmoABC complex mediates electron transfer to sulfite reductase, but Na⁺-NQR may provide ATP for maintaining redox balance .
KEGG: dsa:Desal_0333
STRING: 526222.Desal_0333
NqrE is a membrane-bound component of the Na(+)-translocating NADH:quinone oxidoreductase (Na(+)-NQR) complex found in Desulfovibrio salexigens. This complex catalyzes the reduction of ubiquinone to ubiquinol through two successive reactions, while simultaneously transporting Na(+) ions from the cytoplasm to the periplasm.
Specifically, NqrE, along with other subunits (NqrA to NqrE), is involved in the second step of this process - the conversion of ubisemiquinone to ubiquinol . The NQR complex couples the energy released from NADH oxidation with ubiquinone to transport sodium ions out of the cytoplasm with a 1e⁻/1Na⁺ stoichiometry .
This mechanism generates a sodium motive force (SMF) that drives essential cellular processes such as substrate transport and motility in bacteria . As part of the NqrDE/RnfAE family, NqrE plays a critical role in this energy transduction mechanism .
Based on the available research, E. coli is the most commonly used expression system for recombinant production of NqrE and other NQR complex components . When expressing membrane proteins like NqrE, several key considerations include:
Promoter selection: Physiologically-regulated promoters like the P(BAD) promoter have been successfully used for expression of NQR components in V. cholerae . Similarly, physiologically-regulated promoters under σ factors can improve production of recombinant membrane proteins as demonstrated with other challenging recombinant proteins .
Strain selection: Creating host strains where the genomic copy of the target gene is deleted can facilitate molecular genetics studies and potentially improve recombinant expression .
Tagging strategy: Adding affinity tags like six-histidine (His) tags has proven effective for purification. These tags are typically placed at the C-terminus for NQR subunits, as demonstrated with the NqrF subunit in V. cholerae and commercially available recombinant NqrE proteins .
Expression conditions: Environmental stress responses like osmotic shock with high concentrations of sucrose have been shown to improve production and activity of recombinant membrane proteins by enhancing protein folding .
Purification of recombinant NqrE typically involves:
Membrane preparation: Since NqrE is a membrane protein, cells must first be disrupted, followed by isolation of the membrane fraction through differential centrifugation.
Detergent solubilization: Careful selection of detergents is critical. For the NQR complex, dodecyl maltoside (DM) has been shown to be effective in preserving activity. Using DM during purification helps retain approximately one bound ubiquinone, whereas using LDAO results in negligible quinone content .
Affinity chromatography: His-tagged NqrE can be readily purified using nickel-affinity chromatography, which has been demonstrated to yield highly active forms of NQR complex components .
Buffer optimization: For storage, Tris-based buffers with 50% glycerol have been shown to effectively preserve protein stability . Alternative formulations include Tris/PBS-based buffers with 6% trehalose at pH 8.0 .
Storage considerations: It's recommended to store the purified protein at -20°C or -80°C, with aliquoting necessary to avoid repeated freeze-thaw cycles .
Enzymatic activity of the NQR complex containing NqrE can be assessed through several approaches:
NADH consumption assay: Monitoring the rate of NADH oxidation spectrophotometrically at 340 nm. For instance, recombinant Na(+)-NQR from V. cholerae has demonstrated high specific activity with a turnover number of 720 electrons per second .
Oxygen consumption measurements: Using oxygen electrodes to measure oxygen reduction rates. In Desulfovibrio species, oxidation rates can be highest at air saturation (up to 40 nmol of O₂ min⁻¹ mg of protein⁻¹) and decline with decreasing oxygen concentrations .
Sodium pumping activity: When reconstituted into liposomes, the activity of Na(+)-NQR in generating a sodium gradient can be measured using sodium-sensitive fluorescent dyes or sodium electrodes .
Membrane potential measurements: The ability of the NQR complex to generate an electrical potential (ΔΨ) across the membrane can be measured in liposome systems using voltage-sensitive dyes .
Redox titration: UV-visible spectroscopy can be used to monitor the redox centers within the NQR complex, revealing both n=1 and n=2 redox centers corresponding to the flavins and iron-sulfur clusters in the complex .
Investigating the electron transfer role of NqrE involves several experimental approaches:
Site-directed mutagenesis: Introducing specific mutations in key amino acid residues of NqrE to identify those involved in electron transfer, iron binding, or Na⁺ translocation.
EPR spectroscopy: Electron paramagnetic resonance can be used to characterize the iron center that is embedded in the membrane-bound NqrD and NqrE subunits .
FTIR spectroscopy: Fourier-transform infrared spectroscopy can help identify conformational changes that occur during electron transfer.
Stopped-flow kinetics: Rapid mixing techniques combined with spectroscopic methods can reveal the sequence and rates of electron transfer events within the complex.
Cryo-electron microscopy: Structural studies can provide insights into the spatial arrangement of NqrE and its relationship to other subunits and cofactors in the complex.
Superoxide formation assays: Since Na(+)-NQR produces superoxide during substrate turnover, researchers can investigate whether NqrE contributes to this process by measuring superoxide production using specific probes .
The Na(+)-NQR system in Desulfovibrio shows several distinctive features compared to other electron transport systems:
The Na(+)-NQR complex plays a crucial role in bacterial adaptation through several mechanisms:
Energetic flexibility: By coupling NADH oxidation to Na⁺ translocation, the NQR complex provides an alternative to proton-based energy conservation, which may be advantageous in alkaline or sodium-rich environments.
Oxygen response: In Desulfovibrio species, which are predominantly anaerobes, components of the electron transport chain like NQR may participate in oxygen detoxification mechanisms. D. salexigens shows capacity for oxygen reduction through NADH oxidase activity, although the direct involvement of NqrE in this process requires further investigation .
Stress response integration: The activity of NQR components is likely modulated in response to environmental stressors. For instance, polyglucose accumulation in D. salexigens appears to protect oxidative activities during oxygen exposure .
Redox homeostasis: The NQR complex may contribute to maintaining cellular redox balance by coupling NADH oxidation to quinone reduction and sodium translocation.
Desulfovibrio species have emerged as potential pathobionts with links to various human diseases:
Gut microbiome disturbances: Though typically minor residents of the healthy gut, Desulfovibrio can become opportunistic pathobionts that overgrow in various intestinal and extra-intestinal diseases .
Disease associations: Increasing evidence correlates Desulfovibrio overgrowth with various human diseases, including inflammatory bowel disease and potentially Parkinson's disease .
Pathogenic mechanisms: Several pathogenic mechanisms involve components of Desulfovibrio that could potentially include the NQR complex:
Hydrogen sulfide production: Desulfovibrio generates H₂S through dissimilatory sulfate reduction, which at high concentrations can be toxic to colonocytes .
Lipopolysaccharide (LPS) effects: LPS from Desulfovibrio can induce proinflammatory cytokines like IL-6 and IL-8 in various cell types .
Barrier disruption: Desulfovibrio can impair intestinal barrier integrity by disrupting tight junction proteins and upregulating transcription factors like Snail1 .
Potential NQR involvement: While the direct involvement of the NQR complex in pathogenesis has not been specifically established, its role in energy metabolism suggests it could contribute to bacterial survival and growth during infection. Additionally, the production of superoxide during Na(+)-NQR activity might contribute to oxidative stress during host-pathogen interactions.
Several genetic engineering approaches can be employed to investigate NqrE:
Site-directed mutagenesis: Creating specific amino acid substitutions can help identify residues crucial for:
Membrane integration and topology
Interaction with other NQR subunits
Iron center coordination
Na⁺ ion translocation
Domain swapping: Exchanging domains between NqrE proteins from different bacterial species can help identify regions responsible for species-specific differences in function or stability.
Deletion analysis: Creating truncated versions of NqrE can help determine minimal functional domains required for activity.
Reporter protein fusions: Fusing NqrE with reporter proteins like GFP can provide insights into its cellular localization and assembly into the NQR complex.
Construction of nqrE-deletion strains: Creating D. salexigens strains lacking nqrE would allow assessment of its physiological importance, similar to the approach used for studying NQR in V. cholerae .
Complementation studies: Reintroducing wild-type or mutant versions of nqrE into deletion strains can confirm the function of specific domains or residues.
Researchers face several challenges when working with recombinant NqrE:
Membrane protein expression barriers:
Strategy: Use physiologically-regulated promoters like those under σ regulation, which have been shown to increase recombinant enzyme activity .
Method: Implement osmotic shock with high concentrations of sucrose to improve protein folding and activity, as demonstrated with other recombinant enzymes .
Protein aggregation:
Strategy: Optimize expression conditions including temperature, induction timing, and media composition.
Method: Consider co-expression with chaperones, although it's worth noting that for some recombinant proteins, the benefits of osmotic shock may be due to general stress responses rather than specific chaperone action .
Activity preservation during purification:
Lack of standardized protocols:
Strategy: Implement comprehensive reporting of experimental conditions as recommended by STRENDA DB guidelines.
Method: Include critical parameters such as enzyme and substrate concentrations, buffer composition including counter-ions, and detailed methodologies for determining enzyme kinetic parameters .
Functional reconstitution:
Several cutting-edge technologies hold promise for advancing NqrE research:
Cryo-electron microscopy: Advances in cryo-EM could allow determination of the high-resolution structure of the entire NQR complex, including NqrE, providing insights into the spatial arrangement of cofactors and the mechanism of Na⁺ translocation.
High-throughput enzyme kinetics (HT-MEK): This newly developed technology compresses years of enzyme experimentation into weeks by enabling thousands of enzyme experiments to be performed simultaneously . Applied to NqrE, it could rapidly evaluate the effects of mutations on activity.
Nanodiscs and styrene-maleic acid lipid particles (SMALPs): These technologies provide alternatives to detergent solubilization for membrane proteins, potentially preserving native-like lipid environments around NqrE for functional studies.
Time-resolved spectroscopy: Advanced spectroscopic techniques with microsecond to femtosecond resolution could track electron transfer through the NQR complex, revealing the specific role of NqrE in this process.
Computational approaches: Molecular dynamics simulations could model Na⁺ ion movement through the NQR complex, while quantum mechanical calculations could provide insights into electron transfer mechanisms.
Research on NqrE has significant implications for both basic science and applied research:
Evolutionary insights: Comparative analysis of NqrE across different bacterial species could illuminate the evolution of diverse bioenergetic strategies.
Bioenergetic mechanisms: Detailed understanding of NqrE function within the NQR complex could reveal novel mechanisms of coupling electron transfer to ion translocation.
Antimicrobial potential: As noted in search result , NQR's influence on iron metabolism makes it a potential drug target for antibiotics. Understanding the structure and function of NqrE could contribute to rational drug design efforts targeting this complex.
Host-microbe interactions: Given the role of Desulfovibrio as a potential pathobiont in human disease , understanding NqrE function could provide insights into how these bacteria adapt to host environments and potentially cause disease.
Biotechnological applications: Knowledge of the Na⁺-translocating NQR system could inspire development of novel biosensors or bioelectronic devices that harness the electron transfer capabilities of these systems.
Environmental adaptations: Understanding how NqrE contributes to bacterial survival in different environments could provide insights into microbial ecology and the role of Desulfovibrio in various ecosystems.