Recombinant Desulfovibrio salexigens UPF0059 membrane protein Desal_2561 (Desal_2561)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mntP; Desal_2561; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)
Target Names
mntP
Target Protein Sequence
MPFYEIFIISVALAMDAFTIAVACGLCMPEVSKRQNFRLSFHFGLFQALMPLLGWLAGLT VKSMVETYAPWISFFLLAFVGGKMIQESFETDDSCDTYKDPTKGLSLVFLSVATSLDALA VGLSFSIMDYPIAFPCVMIGITALVLTSFGLWLGKSFAKASSYSHIAERIGGVVLILIGL KLLLQ
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of Desal_2561 relate to its predicted function?

The Desal_2561 protein belongs to the UPF0059 membrane protein family and contains multiple transmembrane domains, characteristic of membrane transport proteins. The hydrophobic amino acid clusters in regions such as "VALAMDAFTIAVACGLCMPE" and "VGLSFSIMDYPIAFPCVMIGIТАЛVLТSFGLWLGK" suggest membrane-spanning domains typical of transport proteins .

As a putative manganese efflux pump (MntP), its structure likely enables the transport of manganese ions across the bacterial membrane. The protein contains conserved domains that are predicted to form a channel or pore structure, facilitating the controlled movement of manganese ions. Researchers should consider using structural prediction tools such as TMHMM, PSIPRED, or I-TASSER to generate models of the transmembrane topology before designing mutagenesis or functional studies.

What are the optimal storage conditions for recombinant Desal_2561?

For optimal retention of protein structure and function, recombinant Desal_2561 should be stored according to these guidelines:

Storage PeriodRecommended ConditionsAdditional Considerations
Long-term-20°C to -80°C in aliquotsAdd 50% glycerol final concentration
Medium-term-20°CAvoid repeated freeze-thaw cycles
Working stock4°CUse within one week

It is critical to avoid repeated freeze-thaw cycles as they significantly reduce protein activity and stability . For maximum stability, the protein is typically supplied in a Tris-based buffer with 50% glycerol (commercial preparations) or Tris/PBS-based buffer with 6% Trehalose at pH 8.0 when lyophilized .

How should recombinant Desal_2561 be reconstituted for experimental use?

When reconstituting lyophilized Desal_2561 protein:

  • Briefly centrifuge the vial before opening to ensure all material is at the bottom.

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

  • For storage preparations, add glycerol to a final concentration of 5-50% (with 50% being the recommended standard).

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

  • If using for membrane incorporation studies, consider reconstitution in buffers containing mild detergents that maintain membrane protein structure .

What experimental evidence supports Desal_2561's function as a manganese efflux pump?

While the search results identify Desal_2561 as a putative manganese efflux pump (MntP) , researchers should conduct validation experiments to confirm this function. Recommended approaches include:

  • Metal Ion Transport Assays: Use radioactive ⁶⁵Mn²⁺ or fluorescent manganese indicators to measure transport activity in reconstituted proteoliposomes or expression systems.

  • Growth Complementation Studies: Express Desal_2561 in bacterial strains with manganese homeostasis defects to determine if it can rescue manganese sensitivity phenotypes.

  • Metal Binding Assays: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure direct binding of manganese ions to purified Desal_2561.

The experimental design should include appropriate controls such as inactive mutant versions of the protein and other divalent metal ions to establish specificity for manganese.

How can I verify the purity and integrity of commercial recombinant Desal_2561?

To confirm protein quality before experimental use:

  • Perform SDS-PAGE analysis to verify size (approximately 20-22 kDa plus tag size) and purity (should be >90% as indicated in commercial specifications) .

  • Conduct Western blotting with anti-His antibodies (for His-tagged versions) or specific antibodies against Desal_2561 if available.

  • Check protein folding using circular dichroism (CD) spectroscopy, particularly important for membrane proteins.

  • If possible, perform a functional assay to confirm activity before proceeding with complex experiments.

  • For membrane proteins, consider native PAGE with mild detergents to assess oligomeric state.

What are recommended approaches for studying Desal_2561 function in membrane contexts?

As a membrane protein, studying Desal_2561 requires specialized approaches:

  • Proteoliposome Reconstitution: Incorporate purified Desal_2561 into artificial liposomes with defined lipid composition to study transport activity in a controlled environment.

  • Controlled Expression Systems: Use inducible expression systems to produce Desal_2561 in bacterial or eukaryotic cells for in vivo functional studies.

  • Fluorescence-Based Transport Assays: Employ fluorescent manganese sensors to monitor real-time transport across membranes.

  • Patch-Clamp Electrophysiology: For detailed kinetic and mechanistic studies, consider patch-clamp analysis of Desal_2561 in suitable expression systems.

When designing these experiments, control for membrane integrity, protein orientation in the membrane, and potential effects of fusion tags on protein function.

How can site-directed mutagenesis be effectively applied to study Desal_2561 function?

Site-directed mutagenesis provides powerful insights into structure-function relationships. For Desal_2561:

  • Target conserved residues within the UPF0059 family, particularly charged residues that might participate in metal binding or transport.

  • Focus on transmembrane domains to identify residues forming the transport channel.

  • Consider the following mutation categories:

    • Conservative mutations (e.g., D→E) to test the importance of specific chemical properties

    • Charge-reversing mutations (e.g., D→K) to test electrostatic interactions

    • Alanine scanning to identify essential residues

    • Cysteine substitutions for accessibility studies

  • Express and purify mutant proteins using identical conditions to wild-type to ensure comparable results.

  • Analyze each mutant using a combination of structural (CD spectroscopy) and functional assays to distinguish between mutations affecting protein folding versus those specifically altering transport function.

How can researchers troubleshoot low activity of recombinant Desal_2561?

When facing challenges with protein activity:

  • Detergent Selection: Test multiple detergent types and concentrations for protein extraction and purification, as inappropriate detergents can denature membrane proteins.

  • Buffer Optimization: Adjust pH, ionic strength, and presence of stabilizing agents (glycerol, specific lipids) to identify optimal conditions.

  • Expression Conditions: Modify induction temperature, duration, and inducer concentration to improve properly folded protein yield.

  • Reconstitution Method: For functional studies, compare different reconstitution methods (detergent dialysis, rapid dilution, direct incorporation) to identify optimal approaches.

  • Co-factors: Test if adding potential co-factors such as manganese or other divalent cations improves stability or activity.

A systematic approach to troubleshooting, changing one variable at a time, will help identify optimal conditions for Desal_2561 activity.

How should contradictory results in Desal_2561 functional studies be interpreted?

When facing contradictory results:

  • Examine Experimental Conditions: Small differences in buffer composition, temperature, or protein preparation can dramatically affect membrane protein function.

  • Consider Protein Orientation: In reconstitution systems, confirm the orientation of Desal_2561 in membranes, as incorrect orientation can lead to apparent loss of function.

  • Assess Oligomeric State: Determine if Desal_2561 functions as a monomer or oligomer under different conditions, as this could explain functional differences.

  • Validate Assay Methods: Use complementary approaches to measure activity, as different assays may detect different aspects of protein function.

  • Statistical Analysis: Apply appropriate statistical tests to determine if observed differences are significant or within the range of experimental variation.

How can Desal_2561 research contribute to understanding bacterial manganese homeostasis?

Manganese is an essential micronutrient and cofactor for many bacterial enzymes, but excess manganese can be toxic. Research on Desal_2561 can:

  • Elucidate mechanisms of bacterial metal ion homeostasis, particularly in anaerobic bacteria like Desulfovibrio.

  • Identify conserved mechanisms of manganese efflux across bacterial species by comparative studies with other MntP homologs.

  • Provide insights into bacterial adaptation to metal-rich environments.

  • Contribute to understanding how pathogens manage manganese during infection, as metal homeostasis is a critical aspect of host-pathogen interactions.

  • Potentially identify novel targets for antimicrobial development, as disruption of metal homeostasis can inhibit bacterial growth.

What are recommended experimental designs for comparing Desal_2561 with other manganese transport proteins?

For comparative studies:

  • Phylogenetic Analysis: Construct phylogenetic trees of MntP homologs across diverse bacterial species to identify conserved regions and species-specific adaptations.

  • Structural Comparison: Use computational modeling and experimental approaches (CD spectroscopy, limited proteolysis) to compare structural features.

  • Functional Complementation: Express Desal_2561 and other manganese transporters in the same genetic background to directly compare their functions under identical conditions.

  • Transport Kinetics: Determine and compare kinetic parameters (Km, Vmax) for manganese transport by different proteins using consistent assay methods.

  • Metal Specificity Profiles: Test transport activity with various divalent cations to establish specificity profiles for each transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.