Recombinant Desulfovibrio vulgaris ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Desulfovibrio vulgaris ATP Synthase Subunit a (atpB)

ATP synthase represents one of nature's most remarkable molecular machines, serving as the primary enzyme responsible for ATP synthesis in virtually all living organisms. In the sulfate-reducing bacterium Desulfovibrio vulgaris, this enzyme plays a particularly vital role in cellular bioenergetics. The ATP synthase complex consists of multiple subunits organized into two major structural components: the membrane-embedded F₀ sector and the catalytic F₁ sector. The subunit a (atpB) is a critical component of the F₀ sector, forming part of the proton channel necessary for energy conversion .

Desulfovibrio vulgaris, a strict anaerobe, relies on sulfate respiration for energy generation, and the ATP synthase complex is integral to this process. Evidence suggests that D. vulgaris produces an F-type ATP synthase in quantities comparable to aerobically cultured Escherichia coli, highlighting its significance in the organism's metabolism . The recombinant production of atpB allows researchers to study this protein independently, enabling detailed investigations of its structure, function, and potential applications in biotechnology and bioenergetics research.

The atpB subunit has been identified as particularly important in the context of alkaline stress response in D. vulgaris, where increased proton pumping by ATP synthase serves as one of the adaptive strategies employed by the microorganism . Understanding the structure and function of this protein component provides valuable insights into the survival mechanisms of this environmentally and industrially significant bacterium.

Expression and Purification Methods

The recombinant production of D. vulgaris atpB involves heterologous expression in E. coli, which provides an efficient system for generating significant quantities of the protein for research purposes . The expression system utilizes a plasmid vector carrying the atpB gene fused to a sequence encoding an N-terminal histidine tag, enabling simplified purification through affinity chromatography.

The expression process typically involves the transformation of competent E. coli cells with the recombinant plasmid, followed by cultivation under controlled conditions to induce protein production. After cell harvesting and lysis, the membrane fraction containing the recombinant atpB protein is isolated and subjected to detergent solubilization to extract the membrane-embedded protein.

Purification of the recombinant protein typically employs a multi-step process:

  1. Affinity chromatography using immobilized metal affinity chromatography (IMAC) to capture the His-tagged protein

  2. Size exclusion chromatography to separate the protein from contaminants based on molecular size

  3. Additional chromatographic steps as needed to achieve high purity

The final purified product is typically formulated in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps stabilize the protein during lyophilization and storage . The resulting lyophilized powder exhibits a purity greater than 90% as determined by SDS-PAGE analysis, making it suitable for various research applications.

Functional Role in Desulfovibrio vulgaris

The ATP synthase complex in D. vulgaris plays a crucial role in the organism's energy metabolism, particularly in the context of sulfate respiration. As a sulfate-reducing bacterium, D. vulgaris employs a unique energy conservation strategy that involves the generation of a proton gradient across the cytoplasmic membrane. The F-type ATP synthase, including the atpB subunit, utilizes this proton gradient to drive ATP synthesis .

Studies have demonstrated that D. vulgaris produces ATP synthase in quantities comparable to aerobically grown E. coli, suggesting its critical importance in the organism's energy metabolism . The enzyme functions as a true ATP synthase, rather than primarily as an ATPase, working in connection with sulfate respiration to generate ATP for cellular processes.

The atpB subunit specifically contributes to this process by forming part of the proton channel in the F₀ sector of the ATP synthase complex. This subunit contains critical amino acid residues that facilitate proton translocation across the membrane, converting the energy stored in the proton gradient into mechanical energy that drives the conformational changes required for ATP synthesis in the F₁ sector.

Research has also implicated ATP synthase in the alkaline stress response of D. vulgaris, with increased proton pumping serving as an adaptive strategy under high pH conditions . This highlights the multifunctional nature of the ATP synthase complex in this organism, contributing not only to energy generation but also to pH homeostasis under challenging environmental conditions.

Gene Organization and Evolution

The genes encoding the ATP synthase components in D. vulgaris are organized in an operon, with a specific arrangement that reflects their evolutionary relationships with other bacterial ATP synthases. The gene arrangement follows the order of the δ, α, γ, β, and ε subunit genes, consistent with the organization observed in other bacterial species .

The atpB gene is part of this operon, encoding the a subunit of the F₀ sector of ATP synthase. Sequence analysis of these genes reveals a GC content of approximately 62-64%, which is consistent with other genes in the D. vulgaris genome . This suggests that the ATP synthase genes are native to D. vulgaris rather than being recently acquired through horizontal gene transfer.

Comparative genomic analysis demonstrates significant sequence homology between the ATP synthase subunits of D. vulgaris and those of other bacterial species, supporting the conservation of this essential enzyme complex throughout bacterial evolution. The presence of an F-type ATP synthase in this anaerobic bacterium, similar to those found in aerobic organisms, provides interesting insights into the evolution of energy metabolism across diverse bacterial lineages.

The identification of an F-type ATP synthase in D. vulgaris supports the chemiosmotic hydrogen cyclic model proposed by Odom and Peck as a general mechanism for energy coupling in Desulfovibrio species . This model predicts the generation of a proton gradient through the oxidation of hydrogen molecules coupled to sulfate reduction, with the ATP synthase complex harvesting this energy for ATP production.

Applications and Research Significance

Recombinant D. vulgaris atpB protein has several important applications in biochemical and biophysical research. The primary application documented in the literature is in SDS-PAGE analysis, where it serves as a valuable tool for studying protein structure and interactions . Beyond this specific application, the recombinant protein offers numerous advantages for research on membrane protein structure and function.

The availability of purified recombinant atpB facilitates:

  1. Structural studies using techniques such as X-ray crystallography and cryo-electron microscopy

  2. Functional analyses of proton translocation mechanisms

  3. Investigation of protein-protein interactions within the ATP synthase complex

  4. Development and testing of inhibitors or modulators of ATP synthase activity

  5. Comparative studies of ATP synthases from different organisms

Understanding the structure and function of atpB contributes to our broader knowledge of bioenergetics in sulfate-reducing bacteria, which play important roles in biogeochemical cycling and have potential applications in bioremediation and biotechnology. Research on this protein may also inform the development of new antimicrobial strategies targeting ATP synthase in pathogenic bacteria.

Additionally, the study of ATP synthase in anaerobic organisms like D. vulgaris provides valuable insights into the evolution of energy metabolism and the adaptation of life to various environmental conditions. This knowledge has implications for understanding the diversity of life on Earth and potentially for astrobiology and the search for life in extreme environments.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
atpB; DVU_0918; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
Target Names
atpB
Target Protein Sequence
MAGGLPHPVLWSTLLNVDTITIGGATVEFKHVFYTWCAMAILFSLGLIVRSSLKVVPGAL QNVFEVVIGGLEDFVVGNIGEDGRKVFPLLGGIFLFILFQNLLGLVPGCDAPTANVNTNA AMALFVFGYYNYQGLKRWGPGYIKHFMGPMTWLTPLMLPLEIISHCARPLSLTLRLFGNI RGEEIVMVLFFLMAPIVGTLPVYFLFLLGKVLQAFIFFMLTMVYLKGAFEHAH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: dvu:DVU0918

STRING: 882.DVU0918

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.