Recombinant Desulfovibrio vulgaris ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Characteristics

  • Function: The atpF subunit is part of the F0 sector of the ATP synthase, which is embedded in the cell membrane and is responsible for proton translocation .

  • Occurrence: Desulfovibrio vulgaris is a sulfate-reducing bacterium . These bacteria are anaerobes, meaning they thrive in the absence of oxygen, and they use sulfate as a terminal electron acceptor in their energy metabolism .

  • Role in ATP Synthesis: ATP synthase uses the proton gradient generated across the cell membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate . The atpF subunit is essential for the proper assembly and function of the ATP synthase complex .

Structure and Sequence Information

The atpF gene encodes the ATP synthase subunit b. Sequence analysis predicts that the protein products share considerable identity at the amino acid level with subunits found in other F-type ATPases .

Recombinant Production

Recombinant Desulfovibrio vulgaris ATP synthase subunit b (atpF) can be produced in E. coli . Recombinant proteins are produced by introducing the gene encoding the protein of interest into a host organism, such as E. coli, which then expresses the protein .

ATP Synthase and Sulfate Reduction

Desulfovibrio vulgaris uses sulfate as a terminal electron acceptor. Although D. vulgaris produces 2 mol of ATP through the oxidation of 2 mol of lactate to acetic acid, they are used out for the formation of adenosine 5′-phosphosulfate during the reduction of a sulfate ion . Thus, for living activity, the bacterium should have other ATP-generating systems, such as an energy conversion system coupled to the electron transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
atpF; DVU_0779; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
Target Names
atpF
Target Protein Sequence
MTLFFASMAYASGDSGHGPDWGNFAFRVVNFVIFAGIIWKAAGKKIVGFFTGRRQGIEQE LNDLETRKTEAKKQLAEVERRIANLESERQAILADYRAQGENIKAAIIDKAEKSASLITE QAKRTADNEIKAAIDAMRAQMADEIIVAAEKLLAEKLTANEHEKLIDKYLTKVVLN
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These are linked by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that connects F(1) and F(0).
Database Links

KEGG: dvu:DVU0779

STRING: 882.DVU0779

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase in Desulfovibrio vulgaris metabolism?

The F-type ATP synthase in D. vulgaris Miyazaki F functions as an ATP-producing enzyme in connection with sulfate respiration. Evidence shows that this enzyme works as an ATP synthase in D. vulgaris cells rather than as an ATP-consuming proton pump. The amount of F-type ATPase produced in D. vulgaris cells is comparable to that in aerobically cultured Escherichia coli cells, indicating its significant role in energy metabolism . This enzyme is particularly important because while D. vulgaris produces ATP through lactate oxidation to acetic acid, these ATP molecules are consumed during the formation of adenosine 5′-phosphosulfate in sulfate reduction. Therefore, the ATP synthase provides an additional crucial source of energy for cellular activities .

What is the structure and organization of ATP synthase genes in D. vulgaris?

The F-type ATP synthase genes in D. vulgaris Miyazaki F have been cloned and sequenced using genomic DNA libraries and synthetic oligonucleotide probes. The genes are organized into five open reading frames (ORFs 1-5) encoding proteins that correspond to the delta, alpha, gamma, beta, and epsilon subunits of F-type ATPases . The predicted protein sequences indicate that they are composed of:

SubunitORFAmino AcidsCorresponding Subunit in F-type ATPases
ORF-11172delta (δ)
ORF-22488alpha (α)
ORF-33294gamma (γ)
ORF-44471beta (β)
ORF-55134epsilon (ε)

The atpF gene specifically encodes subunit b, which forms part of the peripheral stalk connecting the F1 catalytic domain to the membrane-embedded F0 domain .

How does recombinant expression help in studying ATP synthase components?

Recombinant expression provides several advantages for studying ATP synthase components:

  • It enables production of sufficient quantities of individual subunits for structural and functional studies that would be difficult to obtain from native sources.

  • It allows for site-directed mutagenesis to investigate structure-function relationships.

  • It facilitates the addition of affinity tags for purification and detection.

  • It enables the use of molecular biology techniques for investigating factors that influence the stoichiometric variation of intact protein complexes .

For example, research with chloroplast ATP synthase has demonstrated that recombinant approaches can be used to produce individual subunits that can later be used in reconstitution experiments to rebuild functional complexes .

How does the ATP synthase of D. vulgaris respond to environmental stress conditions?

D. vulgaris has been shown to modify ATP synthase expression and activity in response to various environmental stresses:

  • Metal Toxicity: Exposure to Cu(II) and Hg(II) causes upregulation of mRNA expression for ATP binding proteins and ATPases. Specifically, at 50 μM concentrations, Hg(II) causes four to six-fold increases in expression while Cu(II) causes 1.4 to 3-fold increases. This suggests D. vulgaris uses an ATP-dependent mechanism for adapting to toxic metals in the environment .

  • Oxygen Exposure: As a strict anaerobe, D. vulgaris must protect itself against oxidative stress. The ATP synthase may play a role in maintaining energy homeostasis during periods of oxidative stress.

  • Nitrosative Stress: When exposed to nitrate or nitrite, D. vulgaris demonstrates differential expression of multiple NADH dehydrogenases and transcription factors, which may indirectly affect ATP synthase function .

What are the challenges in expressing and purifying recombinant atpF from D. vulgaris?

Several specific challenges exist when working with recombinant D. vulgaris atpF:

  • Membrane Protein Expression: As a membrane protein component, atpF is hydrophobic and tends to aggregate when expressed recombinantly, often forming inclusion bodies.

  • Toxicity to Host Cells: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to toxicity. Research has shown that co-expression with chaperone proteins like DnaK, DnaJ, and GrpE can substantially increase yields of recombinant proteins that are otherwise difficult to produce .

  • Protein Folding: Ensuring proper folding of recombinant atpF is challenging. Various fusion tags have been tested, with MBP (maltose-binding protein) fusion showing the most promise. For instance, subunit c was successfully expressed only when fused to MBP using the vector pMAL-c2x-malE .

  • Purification Complexity: Purification often requires detergents to solubilize the protein from membranes, which can affect protein structure and activity.

  • Reconstitution Requirements: For functional studies, the protein may need to be reconstituted into liposomes or nanodiscs to mimic its native membrane environment.

What expression systems are most effective for recombinant D. vulgaris atpF production?

Based on research with similar proteins, the following expression systems have shown effectiveness:

  • E. coli-Based Expression:

    • T7 expression systems (pET vectors) for high-level protein production

    • T7 Express lysY/Iq strain has been successfully used for expression of difficult membrane proteins

    • pMAL-c2x vector system for creating MBP fusion proteins, which enhances solubility

  • Expression Enhancement Strategies:

    • Co-expression with chaperones using vectors like pOFXT7KJE3, which expresses DnaK, DnaJ, and GrpE chaperone proteins to improve folding

    • Reduced temperature cultivation (16-25°C) to slow protein synthesis and allow proper folding

    • IPTG concentration optimization to balance expression levels and toxicity

  • Vector Selection:
    Different vectors should be tested for optimal expression, including:

    Vector TypeAdvantagesConsiderations
    pMAL-c2xMBP fusion enhances solubilityCleavage required to remove MBP
    pET-32a(+)Thioredoxin fusion; high expressionMay require refolding
    pFLAG-MACFLAG-tag for detection/purificationLower expression levels

What purification strategies yield highest purity and activity of recombinant atpF?

A multi-step purification approach is recommended:

  • Initial Extraction:

    • Carefully optimize cell lysis conditions (French press or sonication)

    • Use appropriate detergents (DDM, LDAO, or OG) to solubilize membrane proteins

    • Addition of stabilizing agents like glycerol (10-20%) can help maintain protein integrity

  • Purification Steps:

    • Affinity chromatography using fusion tags (His-tag, MBP)

    • Ion exchange chromatography as a secondary purification step

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality Assessment:

    • SDS-PAGE and western blotting to confirm identity and purity

    • N-terminal sequencing to verify the correct protein sequence

    • Mass spectrometry for accurate molecular weight determination

How can the structure and function of purified recombinant atpF be validated?

Several complementary approaches can be used to validate both structure and function:

  • Structural Validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to evaluate folding quality

    • Cross-linking studies to examine interactions with other ATP synthase subunits

    • Antibody recognition using antibodies against native atpF epitopes

  • Functional Validation:

    • Reconstitution assays with other ATP synthase subunits

    • ATP hydrolysis assays to test activity in the assembled complex

    • Proton translocation measurements in reconstituted proteoliposomes

    • Binding assays with known interacting partners

  • Integration Assessment:

    • Complementation studies in atpF-deficient strains

    • Electron microscopy to visualize assembled complexes

    • Blue native PAGE to analyze complex formation

What are effective strategies for reconstituting active ATP synthase complexes using recombinant subunits?

Reconstitution of a functional ATP synthase complex requires:

  • Stepwise Assembly:

    • Sequential addition of subunits in a physiologically relevant order

    • Controlled detergent-mediated reconstitution into liposomes

    • Use of proteoliposomes with defined lipid composition

  • Activity Measurement:

    • ATP synthesis/hydrolysis assays

    • Proton pumping measurements using pH-sensitive dyes

    • Membrane potential measurements with voltage-sensitive probes

  • Optimization Parameters:

    • Lipid-to-protein ratio

    • Buffer composition (pH, ionic strength)

    • Temperature and incubation time during reconstitution

    • Presence of stabilizing factors (ATP, Mg2+)

Successful reconstitution would enable studies on the rotary mechanism of ATP synthesis and how atpF contributes to the structural stability of the complex .

How does recombinant protein production affect ATP metabolism in expression hosts?

Recent research has revealed that:

  • Recombinant protein production in E. coli leads to metabolic stress comparable to a carbon overfeeding response.

  • Contrary to expectations, energy is not a limiting factor during recombinant protein production. Instead, studies show accumulation of ATP and precursor metabolites during recombinant protein expression, indicating their ample formation but insufficient withdrawal due to protein production-mediated constraints in anabolic pathways .

  • This phenomenon is not unique to BL21(DE3) strains but also occurs in E. coli K12 strains using different promoter/vector combinations .

  • The IPTG-induced production of proteins leads to persistent accumulation of key regulatory molecules such as ATP, fructose-1,6-bisphosphate, and pyruvate .

These findings have important implications for optimizing expression conditions for recombinant atpF production, suggesting that metabolic engineering approaches might focus on enhancing anabolic capabilities rather than energy generation.

What is the relationship between laboratory cultivation and genetic changes affecting D. vulgaris protein expression?

Research has revealed that D. vulgaris strains maintained in different laboratories have diverged genetically, affecting fundamental phenotypes:

  • A single nucleotide change within DVU1017, the ABC transporter of a type I secretion system (T1SS), was sufficient to eliminate biofilm formation in D. vulgaris Hildenborough .

  • Two T1SS cargo proteins were identified as biofilm structural proteins, with at least one required for biofilm formation .

  • This laboratory-driven evolution highlights the importance of monitoring genetic changes in laboratory strains, as they can affect experimental outcomes, including recombinant protein expression studies.

  • For researchers working with recombinant D. vulgaris proteins, including atpF, it is advisable to sequence the target genes before expression to ensure they match the expected wild-type sequence .

How might cryo-EM techniques advance our understanding of D. vulgaris ATP synthase structure?

Cryo-electron microscopy (cryo-EM) offers several advantages for studying ATP synthase structure:

  • Complete Complex Visualization: Unlike X-ray crystallography, cryo-EM can provide structural information about the entire ATP synthase complex, including flexible regions like the peripheral stalk where atpF is located.

  • Native Environment Preservation: Samples can be prepared in near-native conditions, preserving physiologically relevant interactions.

  • Conformational States: Multiple conformational states can be captured simultaneously, providing insights into the dynamic operation of the ATP synthase.

  • Resolution Improvements: Recent advances in cryo-EM technology have achieved near-atomic resolution, making it possible to identify specific amino acid interactions.

Future research could focus on:

  • Comparing the structure of D. vulgaris ATP synthase with those from other organisms to identify unique features related to its anaerobic lifestyle

  • Examining how the peripheral stalk, including atpF, adapts to different environmental conditions

  • Visualizing potential structural changes during ATP synthesis and hydrolysis

What role might recombinant D. vulgaris atpF play in understanding the evolution of ATP synthases?

Recombinant atpF can contribute to evolutionary studies in several ways:

  • Comparative Analysis: Expressing atpF from different Desulfovibrio species and other sulfate-reducing bacteria can help trace the evolutionary history of ATP synthases in anaerobic organisms.

  • Chimeric Proteins: Creating chimeric proteins with atpF segments from different species can identify critical functional domains that have been conserved throughout evolution.

  • Ancestral Sequence Reconstruction: Experimental testing of computationally predicted ancestral atpF sequences could provide insights into the evolution of energy conservation mechanisms.

  • Environmental Adaptation: Studying how atpF structure and function varies across Desulfovibrio species from different environments (marine vs. freshwater, free-living vs. gut-associated) could reveal adaptations to specific ecological niches .

How can we leverage D. vulgaris ATP synthase research for biotechnological applications?

Potential biotechnological applications include:

  • Bioenergy Production: Understanding the unique properties of ATP synthase from anaerobic organisms like D. vulgaris could inform the development of bioenergy systems that operate under oxygen-free conditions.

  • Biomimetic Nanomotors: The ATP synthase, including the peripheral stalk where atpF is located, serves as a natural nanomotor that could inspire the design of synthetic molecular machines.

  • Bioremediation: D. vulgaris plays important roles in environmental sulfur cycling and metal reduction. Engineering strains with modified ATP synthase activity could enhance their capabilities for remediating contaminated environments .

  • Medical Applications: Understanding the role of Desulfovibrio in gut health and disease could lead to therapeutic applications targeting ATP synthase function. Research has shown associations between Desulfovibrio overgrowth and various human diseases .

How can we address low expression yields of recombinant D. vulgaris atpF?

Several strategies can improve expression yields:

  • Codon Optimization: Adapting the atpF codon usage to the expression host can significantly improve translation efficiency. For D. vulgaris genes expressed in E. coli, this is particularly important due to differences in GC content.

  • Expression Conditions Optimization:

    • Temperature reduction (16-25°C)

    • Inducer concentration titration

    • Extended expression time at lower temperatures

    • Rich vs. minimal media comparison

  • Fusion Partners: Testing different fusion partners beyond MBP, such as SUMO, GST, or TrxA, which can enhance solubility and expression levels.

  • Host Strain Selection: Strains like C41(DE3) or C43(DE3), specifically designed for membrane protein expression, may yield better results than standard BL21(DE3) strains.

  • Cell-Free Expression: For particularly difficult proteins, cell-free expression systems can bypass toxicity issues and allow direct incorporation into liposomes.

What approaches can resolve protein aggregation during purification?

To address aggregation issues:

  • Detergent Screening: Systematically test different detergents and concentrations:

    • Mild detergents: DDM, LMNG, DMNG

    • Intermediate detergents: DM, UDM

    • Harsh detergents: OG, LDAO (only when necessary)

  • Buffer Optimization:

    • pH ranging from 6.0-8.5

    • Salt concentration (150-500 mM)

    • Addition of glycerol (5-20%)

    • Inclusion of specific lipids (POPC, POPE)

  • Solubilizing Agents:

    • Arginine (50-200 mM)

    • Low concentrations of urea (0.5-1 M)

    • Specific lipids that may co-purify with the protein

  • Alternative Purification Approaches:

    • On-column refolding during affinity purification

    • Size exclusion chromatography in the presence of stabilizing agents

    • Amphipol or nanodisc reconstitution immediately after initial purification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.