Recombinant Desulfovibrio vulgaris Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; DvMF_2606; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)
Target Names
mscL
Target Protein Sequence
MLKAFKEFAVKGNALDMAVGVILGASFGTIVKSLVDDLIMPPIGLVLGGVDFSNLFVTLR DGAAPGPYASLAAAKQAGAVTLNVGVFANTVVSFTIVAFAVFLLVRGVNTLRERLEGPAA PKQQACPFCFSKIDVRATRCPHCTATIG
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological function of MscL in Desulfovibrio vulgaris?

The mechanosensitive channel of large conductance (MscL) in D. vulgaris, like in other bacterial species, functions as an emergency release valve that discharges cytoplasmic solutes upon sudden decreases in osmotic environment. This mechanism prevents cell lysis when bacteria experience hypoosmotic shock. MscL opens in response to increased membrane tension, creating a large pore that allows the rapid efflux of accumulated osmoprotectants and other cytoplasmic solutes, thus relieving turgor pressure that might otherwise rupture the cell . D. vulgaris, as a sulfate-reducing bacterium that can inhabit various environmental niches including the human gut, likely relies on MscL for survival during osmotic transitions that occur in these diverse habitats .

How does the structure of MscL relate to its function?

MscL consists of several identical subunits that form a channel with two main transmembrane domains (TM1 and TM2) per subunit. The protein is highly helical both in detergents and liposomes as confirmed by transmission Fourier transform infrared spectroscopy and circular dichroism studies . Upon membrane tension, MscL undergoes dramatic conformational changes that expand its diameter, opening a pore large enough to allow molecules up to 30 Å in diameter to pass through. This structural transition involves the movement of transmembrane helices guided by a "slide helix" or a series of charges at the cytoplasmic membrane boundary. The channel's ability to sense and respond directly to biophysical changes in the membrane is central to its function and represents a recurring structural/functional theme that extends to more complex channels in higher organisms .

What expression systems are recommended for recombinant D. vulgaris MscL production?

For recombinant expression of D. vulgaris MscL, E. coli-based expression systems remain the most practical choice. When designing your expression construct, consider using vectors with inducible promoters (such as T7 or arabinose-inducible systems) to control expression levels. For membrane proteins like MscL, excessive overexpression can be toxic to the host cell. Including affinity tags (His6 or Strep-tag) at either the N- or C-terminus facilitates purification, though the impact of tags on channel function should be verified. E. coli strains C41(DE3) or C43(DE3), developed specifically for membrane protein expression, often yield better results than standard BL21(DE3). For optimal expression, cultivation at lower temperatures (16-25°C) after induction and the use of mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) for extraction are recommended .

What are the key experimental controls needed when studying MscL activity?

When studying MscL activity, several controls are essential to ensure reliable results. First, empty vector controls should be used to distinguish the activity of recombinant MscL from endogenous mechanosensitive channels in your expression system. Second, include a well-characterized MscL variant (such as E. coli MscL) as a positive control for comparative analysis. Third, prepare channel-inactive mutants (e.g., mutations in the pore region) to confirm that observed activities are specifically due to MscL function. Fourth, when reconstituting channels into liposomes, prepare protein-free liposome controls to establish baseline measurements. Fifth, if using patch-clamp electrophysiology, validate recording conditions with channels of known conductance. Finally, when applying membrane tension or amphipaths as stimuli, establish dose-response relationships to demonstrate specific activation rather than non-specific membrane disruption .

How can I genetically manipulate D. vulgaris to study native MscL expression?

For studying native MscL expression in D. vulgaris, both marker exchange methods and markerless genetic exchange systems can be utilized. The markerless deletion system developed for D. vulgaris Hildenborough is particularly valuable for creating multiple sequential gene modifications. This system employs a counterselectable marker based on the uracil phosphoribosyltransferase enzyme (encoded by upp), which confers sensitivity to the toxic analog 5-fluorouracil (5-FU) .

The procedure involves: (1) Creating a deletion construct containing upstream and downstream regions of your target gene in a suicide vector carrying the upp gene; (2) Introducing this construct into a D. vulgaris strain with a deleted upp gene; (3) Selecting for integrants using appropriate antibiotics; (4) Counterselecting on 5-FU-containing media to identify clones where the plasmid has excised, potentially removing the target gene; (5) Screening for successful deletions by PCR.

For studying MscL specifically, you might consider creating tagged versions by introducing sequences encoding epitope or fluorescent tags at the chromosomal locus. Additionally, creating deletion strains of MscL would help establish its physiological importance in D. vulgaris under various stress conditions .

What are the optimal conditions for heterologous expression of D. vulgaris MscL?

Optimal heterologous expression of D. vulgaris MscL requires careful consideration of several factors. Expression in E. coli should be conducted at reduced temperatures (16-20°C) following induction to minimize inclusion body formation. The induction should be performed at mid-log phase (OD600 ~0.6-0.8) with moderate inducer concentrations (e.g., 0.1-0.5 mM IPTG for T7-based systems). Supplementing the growth medium with glycerol (0.5-1%) can enhance membrane protein expression.

The table below summarizes optimized expression conditions:

ParameterRecommended ConditionRationale
Host strainC41(DE3) or C43(DE3)Better tolerance for membrane protein toxicity
Growth mediumLB or TB + 0.5% glycerolEnhanced membrane development
Induction OD6000.6-0.8Balanced between cell density and metabolic capacity
Inducer concentration0.1-0.5 mM IPTGModerate expression to avoid toxicity
Post-induction temperature16-20°CReduced protein aggregation
Post-induction time12-18 hoursSufficient for protein folding and membrane integration
Membrane extractionGentle detergents (DDM, OG)Preserves channel structural integrity

Following expression, cell lysis should be performed using gentle methods such as enzymatic treatment or French press rather than sonication to preserve the structural integrity of membrane-embedded MscL .

How does codon optimization affect D. vulgaris MscL expression in E. coli?

Codon optimization significantly impacts the heterologous expression of D. vulgaris MscL in E. coli. D. vulgaris has a distinct codon usage bias compared to E. coli, particularly for rare codons encoding arginine, leucine, isoleucine, and proline. Without optimization, these codon differences can lead to translational pausing, premature termination, or protein misfolding.

Alternatively, when preserving the native sequence is important, co-expression with plasmids encoding rare tRNAs (such as pRARE) can effectively compensate for codon bias. This approach maintains the exact protein sequence while addressing the translational limitations.

For experimental verification, comparing expression yields between native and optimized constructs, with and without rare tRNA supplementation, provides valuable insights into the specific codon limitations affecting your particular MscL construct .

What methods are most effective for purifying recombinant D. vulgaris MscL?

Purification of recombinant D. vulgaris MscL requires a carefully designed protocol to maintain protein stability and functionality. The most effective purification scheme involves:

  • Membrane isolation: After cell lysis, differential centrifugation separates the membrane fraction (typically 100,000 × g pellet).

  • Solubilization: The membrane fraction is solubilized using mild detergents; n-dodecyl-β-D-maltoside (DDM) at 1-2% is often effective while preserving channel function. Solubilization should be performed at 4°C for 1-2 hours with gentle agitation.

  • Affinity chromatography: If your construct includes a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective first purification step. Washing with low imidazole concentrations (20-40 mM) removes non-specific binding, followed by elution with higher imidazole (250-500 mM).

  • Size exclusion chromatography: This crucial step separates MscL oligomers from aggregates and other contaminants. Superdex 200 columns are typically suitable for MscL purification.

  • Detergent exchange: If necessary, the detergent can be exchanged during size exclusion chromatography by including the desired final detergent in the running buffer.

Throughout the purification process, it's essential to monitor protein quality using SDS-PAGE, Western blotting, and dynamic light scattering to assess purity and homogeneity. The final purified protein can be concentrated to 1-5 mg/mL, with glycerol (10%) added as a stabilizer for storage at -80°C .

How can I assess the functional activity of purified recombinant MscL?

Assessing functional activity of purified recombinant MscL can be accomplished through several complementary approaches:

  • Patch-clamp electrophysiology: The gold standard for channel characterization, involving reconstitution of purified MscL into liposomes or planar lipid bilayers. This technique allows direct measurement of channel conductance (expected to be approximately 3.6 nS for MscL), gating threshold, and kinetics in response to membrane tension applied via negative pressure. The observation of characteristic large-conductance openings with appropriate tension sensitivity confirms functional MscL activity .

  • Fluorescence-based assays: Reconstitution of MscL into liposomes loaded with self-quenching fluorescent dyes (like calcein) allows monitoring of dye release upon channel activation by membrane-perturbing agents such as lysophosphatidylcholine (LPC). Increasing fluorescence intensity indicates channel opening.

  • In vivo complementation: Expression of recombinant MscL in MscL-deficient bacterial strains followed by osmotic downshock survival assays can confirm physiological function. Complementation restoring survival during hypoosmotic shock provides functional validation.

  • Stopped-flow spectroscopy: Light scattering measurements of proteoliposomes during rapid mixing with hypoosmotic solutions can detect volume changes associated with channel activity, providing a higher-throughput alternative to electrophysiology.

  • EPR spectroscopy: Site-directed spin labeling combined with EPR can detect conformational changes upon channel activation, providing insights into the structural dynamics of the functional channel .

What lipid compositions are optimal for MscL functional reconstitution?

The lipid composition of the reconstitution membrane critically affects MscL function. For optimal functional reconstitution of D. vulgaris MscL, consider the following lipid parameters:

  • Lipid chain length: Phospholipids with acyl chains of 16-18 carbons (such as POPC or POPE) provide an appropriate hydrophobic thickness matching the transmembrane domains of MscL. Shorter chains can lead to hydrophobic mismatch and premature channel activation.

  • Headgroup composition: A mixture of phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) lipids (approximately 7:3 ratio) mimics bacterial membrane composition and typically yields optimal channel function. Including 10-15% of negatively charged lipids (like POPG) is important for proper MscL orientation during reconstitution.

  • Membrane curvature: Including lipids that promote negative curvature (such as PE) can enhance mechanosensitivity by creating stored elastic energy that contributes to channel gating.

  • Membrane thickness: The hydrophobic thickness of the membrane affects the energy required for MscL gating. Thinner membranes generally lower the activation threshold, while thicker membranes increase it.

  • Cholesterol or cholesterol analogs: Small amounts (5-10%) of cholesterol or ergosterol can modulate membrane properties and affect channel sensitivity to mechanical stimuli.

For D. vulgaris specifically, which naturally inhabits anaerobic environments and has membranes rich in branched-chain fatty acids, including some branched-chain phospholipids in the reconstitution mixture may better preserve native channel properties .

How does D. vulgaris MscL compare structurally and functionally to MscL from other bacterial species?

D. vulgaris MscL shares the core structural features common to the highly conserved MscL family while exhibiting species-specific variations that may reflect adaptation to D. vulgaris' unique ecological niches. Compared to the extensively studied E. coli MscL, D. vulgaris MscL maintains the characteristic two transmembrane domain architecture with sequence similarity particularly high in the pore-lining TM1 helix, which contains the conserved constriction point residues.

Key comparative features include:

  • Sequence conservation: D. vulgaris MscL exhibits approximately 65-70% sequence similarity with E. coli MscL, with higher conservation in the transmembrane regions compared to the C-terminal domain.

  • Gating properties: While core mechanosensing mechanisms are conserved, D. vulgaris MscL may have evolved different tension thresholds reflecting the osmotic challenges encountered in its natural environments, including anaerobic sediments and the mammalian gut.

  • C-terminal domain: The cytoplasmic C-terminal domain, which forms a helical bundle, shows more variation across species and likely contributes to fine-tuning channel function. In D. vulgaris, this region may have adapted to interact with species-specific cytoplasmic factors.

  • Oligomeric state: While most characterized MscL channels form pentamers, the oligomeric state of D. vulgaris MscL should be experimentally verified, as variations have been observed across species.

  • Lipid interactions: Species differences in native membrane composition may be reflected in specific lipid-protein interactions that optimize channel function in the host's membrane environment .

What evolutionary insights can be gained from studying D. vulgaris MscL?

Studying D. vulgaris MscL offers valuable evolutionary insights into mechanosensation and osmotic adaptation:

  • Anaerobic adaptation: As an obligate anaerobe, D. vulgaris represents an evolutionary lineage distinct from the facultative anaerobes like E. coli where MscL has been extensively studied. Comparing MscL function between these groups can reveal how mechanosensation adapts to different metabolic contexts and oxygen requirements.

  • Habitat specialization: D. vulgaris inhabits diverse environments including marine sediments, soil, and the mammalian gut. Its MscL may have evolved specific properties to handle the osmotic challenges of these varied niches, potentially revealing principles of environmental adaptation in channel function.

  • Pathogen interaction: Recent findings indicate D. vulgaris may promote inflammation in ulcerative colitis through interactions with gut epithelial immune receptors . Studying whether MscL plays any role in host-microbe interactions could reveal novel functions beyond osmotic regulation.

  • Structural conservation: The MscL channel family exemplifies how fundamental mechanical sensing mechanisms have been conserved while allowing species-specific adaptations. D. vulgaris MscL can help identify which structural elements are invariant (likely essential for core function) versus those that have diverged during evolution.

  • Horizontal gene transfer: Analysis of D. vulgaris MscL in the context of phylogenetic relationships can provide evidence for potential horizontal gene transfer events that may have contributed to the distribution of mechanosensitive channels across bacterial lineages .

How can site-directed mutagenesis be used to investigate D. vulgaris MscL structure-function relationships?

Site-directed mutagenesis offers powerful approaches for probing structure-function relationships in D. vulgaris MscL:

  • Pore constriction mutants: Modifying the hydrophobic constriction residues in the TM1 helix (equivalent to L19, V23, G26 in E. coli MscL) can alter channel gating threshold and kinetics. Substituting these with residues of varying hydrophobicity creates a spectrum of gain-of-function or loss-of-function phenotypes that reveal the energetics of pore opening.

  • Tension sensor residues: Mutating residues at the membrane-facing surfaces of TM1 and TM2 can identify specific lipid interaction sites that sense membrane tension. Systematic substitution with tryptophan, which has a strong preference for the membrane interface, can map the membrane-protein boundary during different conformational states.

  • Inter-subunit interface mutations: Modifying residues at the interfaces between subunits can reveal how subunit interactions stabilize the closed state or facilitate conformational changes during gating. Disulfide crosslinking between engineered cysteines can trap the channel in specific conformational states.

  • Cytoplasmic domain modifications: Truncations or site-specific mutations in the C-terminal domain can elucidate its role in channel assembly, stability, and modulation of gating properties.

  • Introduction of reporter groups: Engineering sites for fluorophore attachment or spin labels enables spectroscopic methods (FRET, EPR) to track conformational changes during gating in real-time.

The table below provides a systematic mutagenesis strategy for key functional regions:

Functional RegionTarget ResiduesMutation StrategyExpected Outcome
Pore constrictionHydrophobic pore-lining residuesSubstitution with polar residuesDecreased gating threshold, increased open probability
Tension sensingResidues at membrane interfacesTryptophan scanningIdentification of lipid-protein interaction sites
Subunit interfacesInterface residuesCysteine pairs for crosslinkingStabilization of specific conformational states
Cytoplasmic domainC-terminal helicesTruncation seriesDetermination of minimal functional unit
Gating pathwayConserved motifs like N-h-h-DAlanine substitutionAltered gating kinetics revealing transition pathways

These approaches can be combined with functional assays to systematically map the structural determinants of MscL mechanosensitivity in D. vulgaris .

What challenges exist in expressing and studying D. vulgaris MscL compared to MscL from other bacteria?

Expressing and studying D. vulgaris MscL presents several distinct challenges compared to MscL from model organisms like E. coli:

  • Anaerobic expression requirements: As D. vulgaris is an obligate anaerobe, expressing its proteins in aerobic hosts like E. coli may result in improper folding or post-translational modifications. Consideration should be given to expression under microaerobic or anaerobic conditions to maintain native protein structure.

  • Codon usage discrepancy: D. vulgaris exhibits a different codon bias compared to common expression hosts, potentially leading to translation inefficiencies. Without appropriate codon optimization or rare tRNA supplementation, expression yields may be significantly lower than for E. coli MscL.

  • Membrane composition differences: D. vulgaris membranes contain unique lipid compositions adapted to anaerobic environments, including higher proportions of branched-chain fatty acids. These differences can affect MscL folding, stability, and function when expressed in heterologous systems with different membrane compositions.

  • Limited genetic tools: Despite recent advances in D. vulgaris genetic manipulation , the genetic toolkit for this organism remains less developed than for model bacteria, complicating native expression studies and in vivo functional characterization.

  • Protein stability concerns: Proteins from anaerobic organisms often show reduced stability when exposed to oxygen during purification. Maintaining reducing conditions throughout the purification process may be critical for obtaining functional D. vulgaris MscL.

  • Functional characterization complexity: Standard electrophysiological techniques may require modification to account for potentially different gating properties, conductance, or tension sensitivity of D. vulgaris MscL compared to well-characterized homologs .

How can advanced imaging techniques be applied to study D. vulgaris MscL dynamics?

Advanced imaging techniques provide powerful approaches for studying the dynamic properties of D. vulgaris MscL:

  • Cryo-electron microscopy (cryo-EM): Single-particle cryo-EM can resolve structural states of MscL at near-atomic resolution. By using tension-mimicking conditions (such as detergents with different alkyl chain lengths or amphipaths), multiple conformational states can be captured. For D. vulgaris MscL, this approach could reveal unique structural adaptations not present in other bacterial MscL channels.

  • High-speed atomic force microscopy (HS-AFM): This technique allows direct visualization of conformational changes in membrane proteins at the nanoscale in real-time. For MscL, HS-AFM can monitor channel opening and closing in response to membrane tension, revealing intermediate states and conformational dynamics specific to D. vulgaris MscL.

  • Single-molecule FRET (smFRET): By introducing fluorophore pairs at strategic positions in D. vulgaris MscL, smFRET enables monitoring of distance changes between protein domains during gating. This approach can characterize the conformational landscape and energy barriers between states that may be unique to D. vulgaris MscL.

  • Super-resolution microscopy: Techniques like PALM/STORM can visualize the distribution and clustering behavior of fluorescently labeled MscL in bacterial membranes with nanometer precision, potentially revealing organism-specific patterns of channel organization.

  • Correlative light and electron microscopy (CLEM): This approach combines fluorescence microscopy's specificity with electron microscopy's resolution, enabling visualization of MscL in its cellular context while resolving structural details.

  • 4D cryo-electron tomography: By flash-freezing cells at different time points after osmotic shock, this technique can capture the native conformational states of MscL within the cellular environment, providing insights into in vivo channel dynamics .

What strategies can overcome common challenges in recombinant D. vulgaris MscL purification?

Purification of recombinant D. vulgaris MscL presents several challenges that can be addressed through specific optimization strategies:

  • Low expression yields: If expression levels are problematic, consider:

    • Testing multiple expression vectors with different promoter strengths

    • Optimizing codon usage for the expression host

    • Co-expressing with molecular chaperones (GroEL/ES, DnaK/J)

    • Using specialized strains like C41(DE3) or Lemo21(DE3) that better tolerate membrane protein expression

    • Screening multiple fusion tags (His, Strep, MBP) for improved expression and solubility

  • Protein aggregation: To minimize aggregation during purification:

    • Maintain low temperature (4°C) throughout all purification steps

    • Include glycerol (10-15%) in all buffers to enhance stability

    • Test different detergents beyond standard DDM, such as LMNG or GDN, which can better preserve oligomeric integrity

    • Add lipids (0.1-0.2 mg/mL) to purification buffers to stabilize the protein

  • Impaired functionality: If purified MscL shows reduced activity:

    • Avoid harsh solubilization conditions; extend extraction time with gentler detergent concentrations

    • Minimize exposure to imidazole by using step gradients during IMAC elution

    • Include reducing agents (1-5 mM DTT or TCEP) to prevent oxidative damage

    • Consider native purification approaches that avoid affinity tags altogether

  • Heterogeneous oligomeric states: To achieve homogeneous preparations:

    • Include an ion exchange chromatography step after initial affinity purification

    • Optimize detergent:protein ratio during solubilization

    • Apply strict size exclusion chromatography cutoffs to isolate the proper oligomeric form

  • Poor reconstitution efficiency: To improve proteoliposome preparation:

    • Optimize protein:lipid ratios (typically 1:100 to 1:1000 w/w)

    • Test different reconstitution methods (detergent dialysis vs. dilution vs. direct incorporation)

    • Include specific lipids that enhance membrane integration (such as POPE or cardiolipin)

How can electrophysiological measurements of D. vulgaris MscL be optimized?

Optimizing electrophysiological measurements of D. vulgaris MscL requires attention to several critical parameters:

  • Patch-clamp configuration selection: While excised inside-out patches are commonly used for MscL studies, cell-attached configuration can provide insights into channel behavior in a more native-like environment. For D. vulgaris MscL, comparing both configurations may reveal context-dependent functional properties.

  • Membrane composition adjustment: The lipid environment dramatically affects MscL gating tension. For D. vulgaris MscL, reconstitution into liposomes with varying compositions including phosphatidylethanolamine (PE), phosphatidylglycerol (PG), and cardiolipin in ratios mimicking D. vulgaris membranes (rather than E. coli-like compositions) may better preserve native channel properties.

  • Pressure application refinement: Use precise pressure-application systems with digital feedback control rather than manual syringe-based systems to apply defined pressure steps. This enables accurate determination of gating thresholds, which may differ between D. vulgaris MscL and better-characterized homologs.

  • Buffer composition optimization: Standard electrophysiology buffers may not be optimal for D. vulgaris proteins. Consider buffers that better mimic D. vulgaris cytoplasmic conditions, including appropriate pH (typically pH 7.0-7.2), ionic strength, and redox potential.

  • Recording temperature control: Most patch-clamp recordings are performed at room temperature, but D. vulgaris typically grows at 30-37°C. Temperature-controlled recordings may reveal physiologically relevant gating properties not observed at room temperature.

  • Subconductance state resolution: MscL exhibits multiple subconductance states during gating. High-bandwidth recordings (10-20 kHz) with appropriate filtering and sampling rates can resolve these transient states, providing insights into the gating mechanism of D. vulgaris MscL.

  • Combined fluorescence-electrophysiology: Simultaneous fluorescence imaging and patch-clamp recording of reconstituted labeled MscL can correlate structural changes with functional states .

What factors influence the reproducibility of functional assays for recombinant D. vulgaris MscL?

Achieving reproducible functional assays for recombinant D. vulgaris MscL requires controlling several critical factors:

  • Protein quality consistency: Batch-to-batch variation in purified protein is a major source of inconsistency. Implementing rigorous quality control metrics—including SEC-MALS to verify oligomeric state, circular dichroism to confirm secondary structure, and mass spectrometry to verify protein integrity—ensures starting material consistency.

  • Lipid preparation standardization: For reconstitution-based assays, lipid preparation methods significantly impact results. Standardize liposome preparation by extrusion through defined membrane pores (typically 100-400 nm), verify size distribution by dynamic light scattering, and confirm unilamellarity through cryo-EM or other appropriate techniques.

  • Reconstitution protocol precision: The protein-to-lipid ratio, detergent removal rate, and reconstitution temperature all affect channel distribution and orientation in proteoliposomes. Develop quantitative metrics for reconstitution efficiency, such as protein recovery assays and sucrose gradient analysis of protein incorporation.

  • Buffer composition control: Minor variations in buffer components, particularly divalent cation concentrations (Ca²⁺, Mg²⁺) and redox conditions, can significantly alter MscL function. Prepare buffers using high-grade chemicals, precisely control pH, and verify osmolarity.

  • Stimulus application precision: Whether using pressure (patch-clamp), osmotic gradients (fluorescence-based assays), or amphipaths (LPC activation), the rate and magnitude of stimulus application must be precisely controlled and quantified.

  • Environmental condition management: Temperature fluctuations, mechanical vibrations, and electromagnetic interference can affect sensitive measurements. Implement environmental controls and include internal standards in each experimental series.

The table below summarizes key parameters to control:

Experimental ParameterControl MethodVerification Approach
Protein qualityStandardized purification protocolSEC-MALS, CD spectroscopy, SDS-PAGE
Lipid compositionDefined lipid mixture preparationTLC, mass spectrometry
Proteoliposome propertiesControlled reconstitutionDLS, freeze-fracture EM, density gradient
Buffer consistencyPrecise component measurementpH, conductivity, osmolarity verification
Stimulus applicationCalibrated pressure/concentration deliveryPressure transducer readings, concentration curves
Environmental conditionsTemperature and vibration controlContinuous monitoring during experiments

By systematically controlling these variables and implementing appropriate quality checks, reproducibility of D. vulgaris MscL functional assays can be significantly improved .

How can D. vulgaris MscL be utilized as a model system for studying mechanosensation?

D. vulgaris MscL offers unique advantages as a model system for investigating fundamental aspects of mechanosensation:

  • Force-from-lipid sensing paradigm: D. vulgaris MscL exemplifies the force-from-lipid (FFL) principle of mechanosensation, where membrane tension directly gates the channel without involvement of cytoskeletal elements or accessory proteins. This provides a minimalist system for studying how membrane forces are converted to protein conformational changes .

  • Evolutionary comparisons: As a member of a different bacterial phylum than the well-studied E. coli, D. vulgaris MscL offers opportunities to examine how mechanosensing mechanisms have evolved in divergent lineages. Comparing tension sensitivity, conductance properties, and gating kinetics between homologs provides insights into conserved versus specialized mechanosensing features.

  • Extreme environment adaptation: D. vulgaris thrives in anaerobic, often sulfide-rich environments that represent unique selective pressures. Its MscL may reveal adaptations for mechanosensation under these distinctive conditions, potentially uncovering novel regulatory mechanisms.

  • Simpler model for complex channels: The core mechanosensing mechanism of MscL shares features with more complex eukaryotic mechanosensitive channels. D. vulgaris MscL's manageable size and structural simplicity make it experimentally tractable while still capturing essential aspects of mechanotransduction found in higher organisms.

  • Microbial community interactions: Recent findings that D. vulgaris interactions with gut epithelial immune receptors may contribute to ulcerative colitis raise intriguing questions about potential roles for mechanosensitive responses in host-microbe interactions, opening new research directions.

  • Structure-based drug design template: The distinctive properties of D. vulgaris MscL could provide a novel template for designing compounds that modulate mechanosensitive channels, with potential applications in treating conditions involving aberrant mechanosensation .

What insights can D. vulgaris MscL provide for developing biotechnological applications?

D. vulgaris MscL offers several promising biotechnological applications based on its unique properties:

  • Controlled release nanosystems: The large pore size of MscL (allowing passage of molecules up to 30 Å in diameter) makes it ideal for developing stimulus-responsive delivery systems. By engineering D. vulgaris MscL with site-specific modifications that allow gating in response to non-native stimuli (pH, light, or specific ligands), nanoscale containers with controllable release properties can be created for drug delivery applications .

  • Biosensors for mechanical forces: The direct tension-sensing capability of MscL can be harnessed to develop biosensors that report on mechanical forces in artificial systems. By coupling MscL gating to fluorescent reporters or electrical readouts, sensitive force-measuring devices can be constructed.

  • Antimicrobial development platform: Recent findings that the antibiotic streptomycin uses MscL as one of its primary paths to the bacterial cytoplasm suggest that D. vulgaris MscL could serve as a platform for developing novel antibiotics that exploit mechanosensitive channels for entry into bacterial cells, particularly anaerobes.

  • Environmental biosensing: D. vulgaris' adaptation to extreme environments suggests its MscL may have unique stability properties. These could be exploited to develop robust biosensors for environmental monitoring in challenging conditions like wastewater treatment facilities or oil reservoirs where this organism naturally occurs.

  • Microfluidic components: The precisely controllable gating of MscL through membrane tension makes it suitable for incorporation into microfluidic systems as nanovalves that respond to pressure differentials.

  • Osmotic energy harvesting: The large conductance and well-defined gating properties of MscL could potentially be exploited in systems designed to harvest energy from osmotic gradients, an emerging area in renewable energy research .

What are the most promising directions for future research on D. vulgaris MscL?

Future research on D. vulgaris MscL should explore several promising directions:

  • High-resolution structural studies across conformational states: Obtaining structures of D. vulgaris MscL in multiple conformational states through cryo-EM or X-ray crystallography would reveal the complete gating pathway and potentially identify unique structural features not present in other bacterial MscL homologs.

  • In vivo dynamics and localization: Investigating the distribution, dynamics, and potential clustering of MscL channels in living D. vulgaris cells using advanced fluorescence microscopy would reveal how these channels function in their native context and whether they show spatial organization correlated with cellular functions.

  • Interaction with D. vulgaris-specific membrane components: Examining how D. vulgaris MscL interacts with unique components of this bacterium's membrane, such as specific lipids or other membrane proteins, could uncover novel regulatory mechanisms for mechanosensation.

  • Role in microbe-host interactions: Given D. vulgaris' presence in the gut microbiome and its potential contribution to inflammatory conditions , investigating whether MscL plays any role in host-microbe interactions, potentially through mechanosensitive responses to the gut environment, represents an exciting frontier.

  • Evolution and adaptation to extreme environments: Comparative studies of MscL from D. vulgaris strains isolated from different environments (marine sediments, freshwater, human gut) could reveal how mechanosensation adapts to diverse ecological niches.

  • Development of D. vulgaris-specific small molecule modulators: Identifying compounds that specifically modulate D. vulgaris MscL function could lead to new tools for studying this channel and potentially novel antimicrobials targeting sulfate-reducing bacteria in clinical or industrial contexts.

  • Integration with other sensory systems: Investigating potential cross-talk between mechanosensation and other sensing modalities in D. vulgaris, such as redox sensing or quorum sensing, could reveal sophisticated integration of environmental signals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.