Recombinant Desulfovibrio vulgaris Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; DVU_1928; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
Target Names
lspA
Target Protein Sequence
MLSLKYRIVLGLAAVVMLIDQGTKWLVEATIPFHGTVPVIHGVFDLVNIRNRGAAFGFLN RSDIEWQFWLFLVATVLAVWAILSLTRASKNEPVLYTAFGLIMGGALGNLVDRIRYRAVV DFLDFYWGEWHWPAFNVADIAICIGAFLAFVAMYRQPSPERGNKE
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links

KEGG: dvu:DVU1928

STRING: 882.DVU1928

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Lipoprotein Signal Peptidase (LspA) in Desulfovibrio vulgaris?

LspA in D. vulgaris functions as an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway. This enzyme is critical for proper lipoprotein maturation, enabling lipoproteins to be correctly localized and functioning within the bacterial cell envelope. In D. vulgaris Hildenborough, the LspA gene is encoded at locus DVU1928 and forms part of a conserved lipoprotein processing system that includes Lgt (DVU0015) and Lnt (DVU1860) . The catalytic mechanism involves two aspartate residues that form a catalytic dyad, similar to other aspartyl proteases, which coordinate the hydrolysis of the peptide bond between the lipoprotein signal peptide and the mature lipoprotein .

How does D. vulgaris LspA compare structurally to LspA from other bacterial species?

D. vulgaris LspA shares structural similarities with other bacterial LspA enzymes, particularly with those from pathogens like Staphylococcus aureus (LspMrs) and Pseudomonas aeruginosa (LspPae), exhibiting sequence identity of approximately 31% with LspPae . The core structure consists of:

  • Four transmembrane helices (H1-H4)

  • Catalytic aspartate residues (Asp118 and Asp136) positioned toward the membrane's outer surface

  • A β-cradle structure that accommodates substrate binding

  • An extracellular loop (EL) between strand 2 in the β-cradle and H2 that shows flexibility important for substrate and inhibitor binding

Crystallographic studies of LspA from related bacteria show that while the core structural elements are conserved, there are species-specific variations in the periplasmic helix (PH) conformation and active site architecture that may influence substrate specificity and inhibitor binding .

What are the optimal conditions for expressing recombinant D. vulgaris LspA?

Recombinant D. vulgaris LspA is optimally expressed using the following methodology:

  • Expression System: E. coli BL21(DE3) or similar strains with a T7 promoter system are commonly used.

  • Fusion Tags: Hexahistidine tags (His6) can be added to either the N- or C-terminus to facilitate purification, though tag removal may be necessary for certain structural or functional studies .

  • Growth Conditions:

    • Medium: LB or auto-induction media supplemented with appropriate antibiotics

    • Temperature: Initial growth at 37°C until OD600 of 0.6-0.8, followed by induction at lower temperatures (16-20°C)

    • Induction: 0.1-0.5 mM IPTG for 16-18 hours

  • Buffer Optimization: Due to the membrane protein nature of LspA, detergent selection is critical:

    • Extraction: LMNG (lauryl maltose neopentyl glycol) at 1% has shown effectiveness

    • Purification: 0.02% LMNG maintains protein stability

  • Yield Considerations: Expression levels are typically modest (1-2 mg/L culture) due to the membrane protein nature of LspA.

When studying LspA in complex with inhibitors such as globomycin, co-expression or post-purification incubation with 5-10× molar excess of the compound has proven effective for structural and functional analyses .

What methods are available for assessing the enzymatic activity of recombinant D. vulgaris LspA?

Several complementary methods can be employed to assess recombinant D. vulgaris LspA activity:

  • Gel-Shift Assay:

    • Principle: Monitoring the migration difference between uncleaved prolipoprotein substrate and cleaved mature lipoprotein

    • Procedure:

      • Reaction mixture contains 12 µM pre-prolipoprotein substrate, 250 µM DOPG, and 1.2 µM Lgt in buffer (50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 0.02% LMNG)

      • Pre-incubation at 37°C for 60 minutes allows Lgt-catalyzed conversion of pre-prolipoprotein to LspA substrate

      • Addition of 0.5 µM LspA initiates cleavage reaction

      • Samples taken at timed intervals and analyzed by SDS-PAGE

    • Analysis: Quantification of band intensities to determine reaction kinetics

  • FRET-Based Assay:

    • Principle: Using synthetic fluorescent peptide substrates containing a FRET pair that changes signal upon cleavage

    • Procedure:

      • Optimized buffer conditions with appropriate detergent micelles

      • Substrate concentrations ranging from 10-100 µM

      • Enzyme concentration of 0.1-0.3 µM

    • Analysis: Continuous monitoring of fluorescence allows real-time kinetic analysis, yielding apparent Km and Vmax values

  • Inhibition Assays:

    • For IC50 determination, assays are performed with varying concentrations of inhibitors (0-3.2 mM)

    • D. vulgaris LspA shows different inhibition profiles compared to other bacterial orthologs:

      • With FRET substrates: IC50 approaching enzyme concentration suggests tight binding

      • With prolipoprotein substrates: Higher IC50 values (171 µM at 0.5 µM enzyme) suggest substrate-dependent inhibition differences

Comparative kinetic parameters for D. vulgaris LspA vs. P. aeruginosa LspA:

ParameterD. vulgaris LspAP. aeruginosa LspA
Apparent Km47 µM10 µM
Vmax2.5 nmol/(mg·min)107 nmol/(mg·min)
Globomycin IC50 (FRET assay)Near enzyme concentrationNear enzyme concentration
Globomycin IC50 (gel-shift)171 µM0.64 µM

These differences suggest species-specific variations in substrate recognition and inhibitor binding .

How do conformational dynamics influence D. vulgaris LspA function and inhibitor binding?

D. vulgaris LspA exhibits significant conformational flexibility that directly impacts its function and inhibitor interactions:

  • Apo State Dynamics:

    • The periplasmic helix (PH) fluctuates on the nanosecond timescale, sampling multiple conformations

    • The dominant conformation in the apo state is closed, occluding the charged active site from the lipid bilayer

    • This conformation serves to protect the polar catalytic residues from the hydrophobic membrane environment

  • Conformational States:

    • Closed state: The β-cradle and PH are approximately 6.2 Å apart, completely occluding the active site

    • Intermediate state: Associated with inhibitor binding and possibly representing a substrate-bound conformation

    • Open state: Forms a trigonal cavity where lipoprotein substrate can sterically fit, allowing entry and correct orientation for signal peptide cleavage

  • Inhibitor-Induced Conformational Changes:

    • When bound to antibiotics like globomycin, the enzyme adopts multiple binding modes with the PH in a more open conformation

    • Electron paramagnetic resonance (EPR) and molecular dynamics (MD) studies reveal that:

      • The apo protein fluctuates between open conformations required for substrate binding and closed states

      • Globomycin stabilizes an intermediate conformation that inhibits both signal peptide cleavage and substrate binding

  • Methodological Approaches:

    • Combined experimental techniques provide the most complete picture:

      • Molecular dynamics simulations reveal nanosecond timescale fluctuations

      • Continuous wave (CW) EPR shows multiple conformational states

      • Double electron-electron resonance (DEER) quantifies distances between the β-cradle and PH in different states

      • X-ray crystallography captures static snapshots of specific conformations

These dynamic properties explain how LspA accommodates and processes a variety of lipoprotein substrates despite having a single active site, and provide insight into the mechanism of inhibition by antibiotics targeting this enzyme .

What structural features of inhibitors are critical for binding to D. vulgaris LspA?

The binding of inhibitors to D. vulgaris LspA involves specific structural features that mimic the enzyme's natural substrate:

  • Key Inhibitor Features:

    • Common Binding Motif: Despite structural differences, effective inhibitors like globomycin and myxovirescin share a conserved 19-atom motif that superimposes along their structures

    • Tetrahedral Intermediate Mimicry: Both inhibitors appear to function as non-cleavable tetrahedral intermediate analogs of the natural lipoprotein substrate

    • β-Hydroxyl Group Positioning: The β-hydroxyl group (from g.Ser in globomycin) lodges between the catalytic aspartates, mimicking the tetrahedral oxyanion intermediate of peptide bond hydrolysis

  • Inhibitor-Specific Interactions:

    • Globomycin:

      • 19-member cyclic depsipeptide containing five amino acids and an α-methyl-β-hydroxy nonanoate

      • Trp57 from the extracellular loop extends over the globomycin molecule, securing it against one side of the substrate-binding surface

      • Forms hydrogen bonds with conserved residues in the active site

    • Myxovirescin:

      • Structurally distinct from globomycin but shares the 19-atom binding motif

      • Induces unfolding of the extracellular loop, allowing Trp57 to contact the macrocycle from the opposite side compared to globomycin binding

  • Extracellular Loop Flexibility:

    • The extracellular loop (EL) between strand 2 and H2 shows remarkable flexibility

    • This flexibility is exploited by different inhibitors:

      • With globomycin: EL forms a half-turn helix

      • With myxovirescin: EL unfolds completely

    • Mutating Gly54 to proline in this loop inactivates the enzyme, confirming the importance of this flexibility

  • Structure-Activity Relationships:

    • The 19-atom motif shared between different inhibitors recapitulates part of the substrate lipoprotein in its proposed binding mode

    • This suggests a rational design strategy for developing new inhibitors by incorporating this motif into scaffolds with desirable pharmacokinetic properties

This structural understanding provides a foundation for developing novel antibiotics targeting LspA with potentially lower resistance development due to the essential nature of the conserved binding interactions .

How can gene deletion studies inform our understanding of D. vulgaris LspA function in vivo?

Gene deletion studies have provided valuable insights into D. vulgaris LspA function in vivo:

  • Genetic Manipulation Approaches:

    • Marker Exchange Mutagenesis: Can be used to generate clean deletion mutants of lspA

    • Single Crossover Disruption: Insertion of suicide vectors containing internal gene fragments

    • Transposon Mutagenesis: Random insertion libraries to identify functional domains and essential regions

  • Phenotypic Characterization:

    • Growth Kinetics: Monitoring growth curves in different media conditions (with various carbon and electron acceptor sources)

    • Substrate Utilization: Testing ability to utilize different sulfur compounds

    • Stress Response: Evaluating resistance to various stressors like oxidative agents, antibiotics, or heavy metals

  • Genomic Context Analysis:

    • The genomic organization of D. vulgaris lspA (DVU1928) is informative:

      • Located downstream of a locus that includes [NiFeSe] and [NiFe]1 hydrogenase genes

      • Proximity to maturation proteins suggests functional coupling

      • Neighboring gene DVU1925 encodes a lipase from the GDSL family (tesA)

    • This genomic context implies a coordinated role in processing lipoproteins associated with energy metabolism proteins

  • Comparative Analysis with Other Deletions:

    • Unlike its essentiality in Gram-negative bacteria, lspA is not essential in Gram-positive bacteria including S. aureus

    • Comparison with deletions in related lipoprotein processing enzymes (Lgt, Lnt) can reveal pathway-specific roles

    • Comparing phenotypes across different Desulfovibrio species can identify species-specific functions

  • Survival Studies:

    • LspA-deficient S. aureus mutants show:

      • Normal growth in rich laboratory media

      • Reduced ability to survive in whole human blood (but normal growth in plasma)

      • Attenuated virulence in mouse models of infection

    • These findings indicate LspA's importance in pathogen-host interactions rather than basic cellular functions

Gene deletion studies thus reveal that while LspA is not essential for basic growth of D. vulgaris, it likely plays important roles in specific environmental contexts, particularly in processing lipoproteins involved in energy metabolism and potentially in environmental adaptation .

What genetic approaches can be used to study D. vulgaris LspA substrate specificity?

Several genetic approaches can be employed to investigate the substrate specificity of D. vulgaris LspA:

  • Global Proteomic Analysis of Lipoproteins:

    • Methodology:

      • Create an lspA deletion or conditional mutant in D. vulgaris

      • Compare the proteome profiles of wild-type and mutant strains using mass spectrometry

      • Specifically analyze the accumulation of prolipoprotein precursors versus mature lipoproteins

    • Expected Outcomes:

      • Identification of the complete set of LspA substrates in D. vulgaris

      • D. vulgaris has approximately 45 genes annotated as coding for putative lipoproteins that may serve as LspA substrates

  • Site-Directed Mutagenesis of the Lipobox:

    • Methodology:

      • Generate mutations in the lipobox region (the conserved sequence around the cleavage site) of known or putative lipoproteins

      • Express these variants in cells with tagged LspA to allow pull-down experiments

      • Analyze processing efficiency through gel shift assays or mass spectrometry

    • Application:

      • This approach revealed that the [NiFeSe] hydrogenase from D. vulgaris has an unusual lipoprotein form lacking a typical signal peptide, with only the lipobox being necessary for correct processing

  • Transposon Mutagenesis Libraries:

    • Methodology:

      • Generate randomly barcoded transposon mutant libraries in D. vulgaris

      • Subject the library to various growth conditions

      • Use next-generation sequencing to identify genetic interactions with lspA

    • Recent Findings:

      • A comprehensive transposon mutant library in D. vulgaris Hildenborough has recently been developed

      • This resource allows identification of genes that show synthetic phenotypes with lspA mutations

  • Substrate Trapping Approaches:

    • Methodology:

      • Generate catalytically inactive LspA variants (e.g., by mutating catalytic aspartates)

      • These variants bind but cannot cleave substrates, effectively "trapping" them

      • Identify trapped substrates by co-immunoprecipitation followed by mass spectrometry

    • Technical Considerations:

      • Mutations must preserve substrate binding while eliminating catalytic activity

      • Common mutations target the catalytic dyad residues (Asp118 and Asp136)

  • Heterologous Expression Systems:

    • Methodology:

      • Express D. vulgaris LspA in a heterologous host where the native LspA has been deleted

      • Introduce various potential substrate proteins and evaluate their processing

      • Use fluorescent protein fusions to monitor processing in vivo

    • Applications:

      • Can identify substrate features that determine species-specific processing

      • Useful for comparing processing efficiency between different bacterial LspA enzymes

These genetic approaches can reveal both the range of natural substrates for D. vulgaris LspA and the specific sequence or structural features that determine substrate recognition and processing efficiency.

How can structural data on D. vulgaris LspA inform the development of selective inhibitors?

Structural data on D. vulgaris LspA provides critical insights for rational design of selective inhibitors:

  • Structure-Based Design Strategy:

    • Key Binding Element Identification:

      • Crystal structures of LspA-inhibitor complexes reveal a critical 19-atom motif shared between structurally distinct inhibitors (globomycin and myxovirescin)

      • This conserved motif appears to recapitulate part of the natural lipoprotein substrate binding mode

      • Incorporating this motif into new molecular scaffolds provides a starting point for inhibitor design

    • Active Site Architecture Exploitation:

      • The catalytic dyad (Asp118 and Asp136) forms a key interaction site for inhibitors

      • The β-hydroxyl group of inhibitors lodges between these aspartates, mimicking the tetrahedral transition state of peptide hydrolysis

      • Molecular scaffolds presenting a properly positioned β-hydroxyl group can serve as effective inhibitors

  • Targeting Conformational Dynamics:

    • Rationale:

      • Molecular dynamics and EPR studies show that LspA samples multiple conformational states

      • The enzyme fluctuates between open (substrate binding), intermediate, and closed conformations

      • Inhibitors like globomycin stabilize intermediate conformations that prevent both substrate binding and catalysis

    • Approach:

      • Design compounds that stabilize non-catalytic conformations

      • Target the flexible extracellular loop (EL) that changes conformation upon inhibitor binding

      • Mutations in Gly54 in this loop inactivate the enzyme, highlighting its importance

  • Species Selectivity Considerations:

    • Comparative Analysis:

      • Structural differences between D. vulgaris LspA and orthologs from other bacteria can be exploited

      • D. vulgaris LspA shows different inhibition profiles compared to P. aeruginosa LspA:

        • Slower kinetics (Vmax of 2.5 vs 107 nmol/(mg·min))

        • Lower substrate affinity (Km of 47 vs 10 μM)

        • Different globomycin sensitivity with lipoprotein substrates (IC50 of 171 vs 0.64 μM)

    • Implementation:

      • Design inhibitors targeting non-conserved regions adjacent to the active site

      • Exploit differences in the extracellular loop composition and dynamics

      • Consider the lipid environment differences between species

  • Resistance Mitigation Strategy:

    • Target Conservation Analysis:

      • The catalytic dyad and 14 additional highly conserved residues surrounding the active site have been identified

      • Resistance mutations affecting these residues would likely interfere with substrate binding and catalysis

      • This suggests LspA inhibitors may have a high barrier to resistance development

    • Multi-Site Binding:

      • Design inhibitors that interact with multiple conserved elements

      • Target both the catalytic site and the substrate binding β-cradle

      • Exploit the conformational flexibility of the enzyme to create inhibitors that bind across different states

These structure-guided approaches can lead to development of potent and selective LspA inhibitors with applications in both basic research and potential therapeutic development against sulfate-reducing bacteria and bacterial pathogens.

How does D. vulgaris LspA contribute to cellular physiology beyond lipoprotein processing?

D. vulgaris LspA's contribution to cellular physiology extends beyond direct lipoprotein processing:

These broader roles indicate that D. vulgaris LspA functions as a critical integration point between protein processing, energy metabolism, and environmental adaptation, making it an important target for both basic research and potential applications in controlling sulfate-reducing bacteria in industrial and environmental contexts.

How does D. vulgaris LspA differ functionally from LspA in pathogenic bacteria?

D. vulgaris LspA shows several important functional differences compared to LspA enzymes from pathogenic bacteria:

  • Enzyme Kinetics and Inhibitor Sensitivity:

    • Comparative Kinetic Parameters:

      ParameterD. vulgaris LspAP. aeruginosa LspAS. aureus LspA
      Apparent Km47 µM10 µMSimilar to P. aeruginosa
      Vmax2.5 nmol/(mg·min)107 nmol/(mg·min)Not directly reported
      Globomycin IC50 (FRET)Near enzyme conc.Near enzyme conc.Similar tight binding
      Globomycin IC50 (gel-shift)171 µM0.64 µMSimilar to P. aeruginosa
    • These differences suggest D. vulgaris LspA is a slower-acting peptidase with lower substrate affinity and different inhibitor sensitivity profiles

  • Essentiality and Physiological Role:

    • Gram-negative Pathogens:

      • LspA is essential in Gram-negative bacteria like P. aeruginosa and E. coli

      • Deletion is lethal due to critical roles in outer membrane organization

    • Gram-positive Pathogens:

      • LspA is not essential in S. aureus and other Gram-positive bacteria

      • Deletion leads to attenuated virulence without affecting basic growth

      • Critical for survival in human blood but not in plasma, suggesting a role in resisting phagocyte killing

    • D. vulgaris:

      • Role centers on energy metabolism and electron transfer rather than virulence

      • Processes specialized lipoproteins involved in sulfate reduction pathway

  • Substrate Range and Specificity:

    • Pathogenic Bacteria:

      • Process lipoproteins primarily involved in:

        • Cell envelope integrity

        • Nutrient acquisition

        • Host-pathogen interactions

        • Antibiotic resistance mechanisms

    • D. vulgaris:

      • Processes unique substrates including:

        • [NiFeSe] hydrogenase and other energy metabolism components

        • Electron transfer proteins in the sulfate reduction pathway

        • Chemotaxis proteins involved in sensing electron acceptors

      • Can process atypical substrates lacking standard signal peptides

  • Structural and Conformational Differences:

    • Binding Pocket Architecture:

      • Species-specific variations in the periplasmic helix (PH) and β-cradle

      • Different extracellular loop (EL) compositions affecting substrate recognition

    • Conformational Dynamics:

      • While all LspA enzymes show conformational flexibility, the specific conformational states and their populations differ between species

      • These differences likely reflect adaptation to different substrate sets and cellular environments

  • Genomic Context and Regulation:

    • Pathogenic Bacteria:

      • Often part of operons related to cell envelope biogenesis

      • Expression typically linked to cell growth rate

    • D. vulgaris:

      • Located in proximity to genes encoding hydrogenases and their maturation proteins

      • Suggests co-regulation with energy metabolism rather than with general envelope biogenesis

These functional differences reflect the distinct physiological roles of LspA in D. vulgaris compared to pathogenic bacteria, with adaptations specific to the anaerobic, sulfate-reducing lifestyle of Desulfovibrio species.

What insights can comparative genomics provide about the evolution of D. vulgaris LspA?

Comparative genomics offers valuable insights into the evolution of D. vulgaris LspA:

  • Phylogenetic Distribution and Conservation:

    • Core Enzyme Features:

      • LspA is widely distributed across bacterial phyla, including both aerobes and anaerobes

      • The catalytic dyad aspartates (positions equivalent to Asp118 and Asp136 in D. vulgaris) are universally conserved

      • 14 additional highly conserved residues surrounding the active site are maintained across diverse species

    • Desulfovibrio-Specific Features:

      • Sequence analysis reveals Desulfovibrio-specific residues in the periplasmic helix and extracellular loop

      • These likely reflect adaptation to the unique lipoproteins processed in sulfate-reducing bacteria

      • D. vulgaris LspA (DVU1928) shares higher sequence similarity with other Deltaproteobacteria LspA proteins than with those from pathogenic species

  • Genomic Context Evolution:

    • Gene Neighborhood Analysis:

      • In D. vulgaris, lspA is located downstream of genes encoding [NiFeSe] and [NiFe]1 hydrogenases

      • This genomic arrangement is conserved in other Desulfovibrio species but not in distantly related bacteria

      • Suggests co-evolution of lipoprotein processing with energy metabolism in sulfate-reducing bacteria

    • Operon Organization:

      • The presence of a GDSL family lipase gene (tesA, DVU1925) near lspA is a unique feature of some Desulfovibrio species

      • This proximity suggests functional coupling between different lipid-modifying enzymes

  • Substrate Co-evolution:

    • Specialized Substrates:

      • The [NiFeSe] hydrogenase in D. vulgaris has evolved as a lipoprotein with atypical processing requirements

      • This enzyme lacks a typical signal peptide but retains the lipobox motif recognized by LspA

      • This suggests co-evolution between enzyme and substrate, with relaxed recognition requirements in D. vulgaris LspA

    • Lipoprotein Repertoire:

      • D. vulgaris has approximately 45 genes annotated as coding for putative lipoproteins

      • This repertoire differs significantly from pathogenic bacteria, focusing on energy metabolism rather than virulence factors

      • LspA has likely co-evolved with this specific set of substrates

  • Structural Adaptations:

    • Comparative Structural Analysis:

      • Structures of LspA from D. vulgaris, P. aeruginosa, and S. aureus reveal both conserved core features and species-specific adaptations

      • The flexibility of the extracellular loop varies between species

      • The β-cradle structure shows adaptations to different substrate specificity

    • Functional Specialization:

      • Lower catalytic efficiency of D. vulgaris LspA (Vmax of 2.5 vs 107 nmol/(mg·min) for P. aeruginosa)

      • Different substrate affinity (Km of 47 vs 10 μM)

      • These differences likely reflect adaptation to the slower growth rate and specialized metabolic requirements of anaerobic sulfate-reducing bacteria

  • Selection Pressure Analysis:

    • Conservation Pattern:

      • Residues involved in catalysis and core structural elements show purifying selection

      • Surface-exposed residues and loops show greater variability

      • The extracellular loop region contains glycine residues (e.g., Gly54) that are critical for function but allow conformational flexibility

    • Adaptive Evolution:

      • Sequence variations in substrate-binding regions reflect adaptation to different lipoprotein sets

      • These variations may contribute to the different inhibitor sensitivity profiles observed between species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.