Recombinant Desulfovibrio vulgaris Protein DVU_0532 (DVU_0532)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

DVU_0532 (UniProt ID: P33392; Gene Name: DVU_0532) is a 226-amino-acid protein encoded by the hmc operon ORF 5 in Desulfovibrio vulgaris. Its primary role remains poorly characterized, but its association with the hydrogenase maturation complex (HMC) operon suggests potential involvement in hydrogen metabolism or redox processes.

PropertyValue
UniProt IDP33392
Gene NameDVU_0532
SynonymsHMC operon ORF 5, Protein DVU_0532
Protein LengthFull-length (1–226 amino acids)
Amino Acid SequenceMYAFLTGPMLWASLLVFFGGLLARVIWYIRGLDWRLDRVAYKPHLAIGLQGAVQSALKWL VPFGTYSWRQQPFFTVAFFLFHIGAVLVPLFLAGHNVILEERFGFSLPALPMGVADTLTV LAIIGLVMIALRRIALTEVRILTTGYDWFILAVSAAPFVTGFLARLHVGDYDTWLLAHII TGELFLIVAPFTKLSHIVLFFMSRGQLGMDYAIKRGGATRGPAFPW
Molecular Weight~25–26 kDa (estimated)
Expression HostE. coli (primary), cell-free systems, and yeast/mammalian cells

Applications and Research Relevance

DVU_0532 is utilized in diverse research workflows:

ApplicationDetails
SDS-PAGEConfirming protein purity and size
ELISA DevelopmentServed as an antigen in immunoassay kits (e.g., 50 µg quantities)
Structural StudiesHis-tagged variants enable immobilization for X-ray crystallography/NMR
Protein InteractionCo-IP or pull-down assays to identify binding partners

Key Research Findings

  1. Regulatory Context: DVU_0532’s promoter overlaps with Rex-binding sites, highlighting its potential role in redox-regulated pathways .

  2. Production Efficiency: Recombinant expression in E. coli yields high-purity protein (>90%), suitable for downstream applications .

  3. Stability Challenges: Lyophilized DVU_0532 requires careful handling to avoid degradation, with aliquoting recommended for long-term storage .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DVU_0532; Protein DVU_0532; HMC operon ORF 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
Target Names
DVU_0532
Target Protein Sequence
MYAFLTGPMLWASLLVFFGGLLARVIWYIRGLDWRLDRVAYKPHLAIGLQGAVQSALKWL VPFGTYSWRQQPFFTVAFFLFHIGAVLVPLFLAGHNVILEERFGFSLPALPMGVADTLTV LAIIGLVMIALRRIALTEVRILTTGYDWFILAVSAAPFVTGFLARLHVGDYDTWLLAHII TGELFLIVAPFTKLSHIVLFFMSRGQLGMDYAIKRGGATRGPAFPW
Uniprot No.

Target Background

Function
The HMC operon in Desulfovibrio vulgaris encodes a transmembrane protein complex composed of HMWC (high-molecular-weight cytochrome c), ORF2, ORF3, ORF4, ORF5, and ORF6. This complex facilitates electron flow from the periplasmic hydrogenase to the cytoplasmic enzymes responsible for sulfate reduction.
Database Links

KEGG: dvu:DVU0532

STRING: 882.DVU0532

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is DVU_0532 and what is its role in Desulfovibrio vulgaris?

DVU_0532 (UniProt ID: P33392) is a protein encoded by the HMC operon (high-molecular-weight cytochrome c) in Desulfovibrio vulgaris, specifically identified as hmcE within the operon. It is part of a gene cluster spanning from DVU0531 to DVU0536 that encodes the complete Hmc complex (hmcF, hmcE, hmcD, hmcC, hmcB, and hmcA) . This complex plays a significant role in the electron transport chain of D. vulgaris and influences hydrogen sulfide (H₂S) production. The Hmc complex functions as an important component in the anaerobic respiration of this sulfate-reducing bacterium, facilitating electron transfer during anaerobic metabolism .

How is recombinant DVU_0532 typically produced for research applications?

Recombinant DVU_0532 is typically produced using E. coli expression systems. The full-length protein (amino acids 1-226) is often fused with an N-terminal His-tag to facilitate purification. The recombinant protein is expressed in E. coli, followed by cell lysis and affinity chromatography using the His-tag. After purification, the protein is typically lyophilized and stored as a powder. For research use, it can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What is the relationship between DVU_0532 and sulfate reduction in D. vulgaris?

DVU_0532 (hmcE) functions as part of the Hmc complex that participates in electron transport processes supporting sulfate reduction. While not directly involved in the core sulfate reduction pathway (which includes enzymes like sulfate adenylyltransferase, APS reductase, and sulfite reductase), the Hmc complex facilitates electron flow that ultimately enables the reduction of sulfate to hydrogen sulfide. Research indicates that the Hmc complex is integral to the energy conservation mechanisms in D. vulgaris during anaerobic growth on sulfate . Expression data shows that genes in the Hmc complex, including DVU_0532, have similar expression patterns under various growth conditions, suggesting coordinated regulation of this electron transport machinery in response to environmental factors .

What are the optimal storage and handling conditions for recombinant DVU_0532?

Recombinant DVU_0532 requires careful handling to maintain its structural integrity and biological activity. The lyophilized protein should be stored at -20°C to -80°C upon receipt. For working solutions, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. The addition of glycerol (typically 5-50% final concentration) is recommended to prevent freeze-thaw damage.

For short-term use, working aliquots can be stored at 4°C for up to one week. Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein structure and function. The protein is typically stored in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose as a stabilizer. Before opening any vial, it should be briefly centrifuged to bring contents to the bottom .

What analytical methods are recommended for quality assessment of recombinant DVU_0532?

Several analytical methods can be employed to assess the quality and integrity of recombinant DVU_0532:

  • SDS-PAGE: The primary method for assessing purity, with quality recombinant DVU_0532 preparations typically showing >90% purity by SDS-PAGE analysis.

  • Western Blotting: Useful for confirming identity, especially when using antibodies against the His-tag or specific to DVU_0532 itself.

  • Mass Spectrometry: For precise molecular weight determination and verification of post-translational modifications.

  • Circular Dichroism (CD): To evaluate secondary structure integrity.

  • Size Exclusion Chromatography: To assess aggregation state and homogeneity.

Given the membrane-associated nature of DVU_0532, particular attention should be paid to the presence of properly folded protein versus aggregated forms when evaluating quality .

How can researchers effectively solubilize and reconstitute DVU_0532 for functional studies?

Effective solubilization and reconstitution of DVU_0532 requires protocols that accommodate its membrane-associated characteristics:

  • Initial Reconstitution: Dissolve lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Buffer Selection: Tris-based buffers at pH 8.0 are typically effective, often supplemented with stabilizers such as trehalose.

  • Detergent Considerations: For functional studies, gentle detergents like n-dodecyl β-D-maltoside (DDM) or digitonin may be necessary to maintain native conformation while providing solubility.

  • Membrane Reconstitution: For electron transport studies, reconstitution into liposomes or nanodiscs may be required to recreate the native membrane environment.

  • Protein Concentration: Working concentrations should be optimized based on the specific assay, typically ranging from 0.1-1.0 mg/mL.

The addition of glycerol (typically 5-50%) helps maintain stability during storage. For functional assays, researchers should consider maintaining anaerobic conditions that mimic the native environment of D. vulgaris .

How does DVU_0532 contribute to the electron transport mechanism in the Hmc complex?

DVU_0532 (hmcE) functions as a key component of the Hmc electron transport complex in D. vulgaris. The Hmc complex (encoded by genes DVU0531-DVU0536) represents a specialized electron transfer system that facilitates anaerobic respiration in this sulfate-reducing bacterium.

Within this complex, DVU_0532 likely contributes to creating an electron transfer conduit across the membrane. Based on sequence analysis and expression patterns, DVU_0532 works in concert with other Hmc components to shuttle electrons from cytoplasmic electron carriers to membrane-bound complexes involved in energy conservation. RNA-seq and transcriptomic data indicate that DVU_0532 is co-expressed with other components of the Hmc complex (hmcF, hmcD, hmcC, hmcB, and hmcA), showing similar expression levels (approximately -15.2 ± 1.4 log expression relative to genomic DNA) across various growth conditions .

Research suggests that the Hmc complex, including DVU_0532, provides alternative electron flow pathways that allow D. vulgaris to optimize its energy metabolism depending on environmental conditions. This flexibility is particularly important for adaptation to fluctuating sulfate availability and redox conditions in natural environments.

What is the relationship between DVU_0532, the Hmc complex, and regulation of biofilm formation?

The relationship between DVU_0532 (as part of the Hmc complex) and biofilm formation is mediated through the σ54-dependent regulator DVU2956. Research has shown that DVU2956 regulates both biofilm formation and H₂S production in D. vulgaris. When DVU2956 is produced, it inhibits biofilm formation and reduces H₂S production by influencing electron transport via the Hmc complex (which includes DVU_0532) and Fe-only hydrogenase.

Specifically:

  • Production of DVU2956 in biofilms decreased H₂S production by approximately 50%

  • Deletion of dvu2956 increased H₂S production by 131 ± 5%

  • Production of DVU2956 in the dvu2956 knockout strain reduced H₂S production

These findings indicate that DVU_0532, as part of the Hmc complex, is an important target of DVU2956-mediated regulation. The modulation of electron flow through the Hmc complex appears to be a key mechanism by which DVU2956 controls the switch between planktonic and biofilm lifestyles in D. vulgaris. This regulatory relationship highlights the importance of DVU_0532 in the physiological adaptations of D. vulgaris to different growth conditions .

What techniques are most effective for studying protein-protein interactions involving DVU_0532 within the Hmc complex?

Given the membrane-associated nature of DVU_0532 and its function within the Hmc complex, several specialized techniques are particularly effective for studying its protein-protein interactions:

  • Crosslinking Mass Spectrometry (XL-MS): This technique can capture interactions between DVU_0532 and other components of the Hmc complex by creating covalent bonds between closely associated proteins, followed by MS identification of crosslinked peptides.

  • Blue Native PAGE: Particularly useful for analyzing intact membrane protein complexes, this technique can help determine the native oligomeric state of DVU_0532 within the Hmc complex.

  • Co-immunoprecipitation with His-tagged DVU_0532: Using the available recombinant His-tagged DVU_0532, researchers can pull down interaction partners from D. vulgaris lysates.

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified DVU_0532 and other purified components of the electron transport chain.

  • Bacterial Two-Hybrid Systems: Adapted for membrane proteins, these systems can detect interactions in a cellular context.

  • Cryo-Electron Microscopy: For structural determination of the entire Hmc complex, providing insights into how DVU_0532 interfaces with other components.

When designing these experiments, it's critical to maintain anaerobic conditions that mimic the native environment of D. vulgaris to preserve physiologically relevant interactions .

How does the expression of DVU_0532 vary under different environmental stresses and growth conditions?

Transcriptomic data indicates that DVU_0532 expression, along with other components of the Hmc complex, is sensitive to environmental conditions. The expression level of DVU_0532 (hmcE) has been measured at approximately -15.2 ± 1.4 log2 (RNA to genomic DNA signal ratio) under standard growth conditions.

Analysis across various stress conditions reveals coordinated regulation of the entire Hmc operon (DVU0531-DVU0536), suggesting these genes respond as a functional unit to environmental changes. D. vulgaris has been studied under multiple stress conditions including:

  • Temperature stress (8°C cold shock, 50°C heat shock)

  • Oxygen exposure (0.1%)

  • pH stress (alkaline pH 10, acidic pH 5.5)

  • Nitrite (2.5 mM) and nitrate (105 mM) exposure

  • Salt stress (250 mM sodium, 250 mM potassium)

  • Heavy metal stress (0.45 μM chromate)

  • Growth phase transitions

The comparative expression patterns indicate that the Hmc complex, including DVU_0532, plays a role in adaptation to changing environmental conditions. This adaptive response likely reflects adjustments in electron transport pathways to optimize energy conservation under stress .

What are the major challenges in producing functionally active recombinant DVU_0532, and how can they be addressed?

Producing functionally active recombinant DVU_0532 presents several challenges due to its membrane-associated nature and role in a complex electron transport system:

Challenge 1: Membrane Protein Expression
DVU_0532 contains hydrophobic regions that can lead to inclusion body formation in E. coli expression systems.
Solution: Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)). Lower induction temperatures (16-20°C) and reduced inducer concentrations can improve proper folding. Fusion tags like SUMO or MBP can enhance solubility.

Challenge 2: Maintaining Native Conformation
Extraction from membranes risks disrupting the native structure.
Solution: Employ gentle detergents like DDM, LMNG, or GDN for extraction. Consider using amphipols or nanodiscs for stabilization after purification.

Challenge 3: Reconstituting Functional Activity
Individual components of electron transport chains often lack activity in isolation.
Solution: Co-express multiple components of the Hmc complex (DVU0531-DVU0536) simultaneously or reconstitute the purified components together in liposomes to recreate a functional electron transport system.

Challenge 4: Anaerobic Requirements
D. vulgaris is an anaerobe, and its proteins may be oxygen-sensitive.
Solution: Perform protein purification and activity assays under strict anaerobic conditions using glove boxes or anaerobic chambers with appropriate gas mixtures .

How can researchers effectively measure the electron transport activity of recombinant DVU_0532 in experimental systems?

Measuring the electron transport activity of recombinant DVU_0532 requires specialized approaches that account for its role in the Hmc complex:

  • Reconstituted Proteoliposome Assays:

    • Incorporate purified DVU_0532 along with other Hmc components into liposomes

    • Use artificial electron donors (e.g., reduced methyl viologen) and acceptors

    • Measure electron transfer rates spectrophotometrically by following the oxidation/reduction of dyes

  • Electrode-Based Methods:

    • Protein film voltammetry can measure direct electron transfer to electrodes

    • Modified electrodes with immobilized DVU_0532 and associated components

    • Chronoamperometry to measure current generation as a function of electron flow

  • H₂S Production Assays:

    • Reconstitute DVU_0532 with other components in a system capable of H₂S production

    • Measure H₂S using methylene blue method or specific H₂S probes

    • Compare activity with systems lacking DVU_0532 to determine its specific contribution

  • Coupled Enzyme Assays:

    • Link electron transport to a detectable enzymatic reaction

    • Monitor absorption changes of electron carriers like NAD(P)H or artificial dyes

When designing these assays, it's critical to maintain anaerobic conditions and include appropriate controls to distinguish DVU_0532-specific activity from background electron transfer reactions .

What are the most sensitive approaches for detecting and quantifying H₂S production in systems containing recombinant DVU_0532?

Several sensitive approaches can be employed to detect and quantify H₂S production in experimental systems containing recombinant DVU_0532:

  • Methylene Blue Method:

    • Sensitivity: 0.1-1000 μM H₂S

    • Principle: H₂S reacts with N,N-dimethyl-p-phenylenediamine in the presence of ferric chloride to form methylene blue

    • Detection: Spectrophotometric measurement at 670 nm

    • Advantages: Well-established, relatively simple protocol

  • Fluorescent Probes:

    • Sensitivity: Down to nM range

    • Examples: 7-azido-4-methylcoumarin (AzMC), SF7-AM

    • Principle: Selective reaction with H₂S produces fluorescent product

    • Advantages: Higher sensitivity, potential for real-time measurements

  • Electrochemical Detection:

    • Sensitivity: 0.05-500 μM

    • Principle: Direct oxidation of H₂S at the electrode surface

    • Advantages: Real-time measurements, less interference from media components

  • Gas Chromatography:

    • Sensitivity: 0.01-100 ppm in headspace

    • Principle: Separation and quantification of H₂S in gas phase

    • Advantages: Highly specific, can distinguish H₂S from other volatile sulfur compounds

  • Lead Acetate Test Strips:

    • Sensitivity: 5-10 ppm

    • Principle: Formation of lead sulfide (black precipitate)

    • Advantages: Simple, rapid semi-quantitative assessment

Based on published research with D. vulgaris, systems containing recombinant DVU_0532 showed approximately 30-50% reduction in H₂S production when DVU2956 was expressed, while deletion of dvu2956 increased H₂S production by approximately 131%. These values provide useful benchmarks for expected changes in experimental systems .

How might research on DVU_0532 contribute to understanding and mitigating biocorrosion caused by sulfate-reducing bacteria?

Research on DVU_0532 has significant implications for understanding and potentially mitigating biocorrosion caused by sulfate-reducing bacteria:

  • Mechanism Elucidation: DVU_0532, as part of the Hmc complex, participates in electron transport processes that ultimately lead to H₂S production. H₂S is a key contributor to biocorrosion through formation of iron sulfides and promotion of cathodic reactions on metal surfaces. Understanding how DVU_0532 contributes to electron flow provides insights into the fundamental mechanisms driving biocorrosion.

  • Biofilm Regulation Connection: Research has established that DVU_0532 activity is influenced by DVU2956, a regulator that controls both biofilm formation and H₂S production. Since biofilms are central to biocorrosion processes, this connection offers a potential target for intervention. Specifically, strategies that mimic or enhance DVU2956 activity could simultaneously reduce biofilm formation and H₂S production, thereby mitigating biocorrosion.

  • Inhibitor Development: Detailed knowledge of DVU_0532 structure and function could enable design of specific inhibitors that disrupt electron transport in the Hmc complex, potentially reducing sulfide production without broadly affecting microbial communities.

  • Monitoring Applications: Quantitative assessment of DVU_0532 expression levels could serve as a biomarker for corrosion potential in industrial systems, allowing for early intervention.

Given that biocorrosion results in approximately $100 billion in damage annually, advances in understanding DVU_0532 function could contribute to significant economic benefits through improved corrosion management strategies .

What is the potential for using DVU_0532 and the Hmc complex as targets for controlling sulfate-reducing bacterial activity in industrial settings?

The potential for targeting DVU_0532 and the Hmc complex to control sulfate-reducing bacterial (SRB) activity in industrial settings is promising but requires consideration of several factors:

  • Specificity and Effectiveness:

    • The Hmc complex represents a specific target within SRB metabolism

    • Inhibition of this complex could disrupt electron transport without necessarily killing the bacteria

    • This approach might reduce H₂S production while minimizing selection pressure for resistance

  • Potential Intervention Strategies:

    • Small molecule inhibitors designed to interfere with DVU_0532 function

    • Peptide-based approaches that disrupt protein-protein interactions within the Hmc complex

    • RNA-based technologies to suppress DVU_0532 expression

    • Biomimetic approaches that simulate DVU2956 regulatory effects

  • Implementation Considerations:

    • Delivery mechanisms for inhibitors in industrial systems

    • Stability of inhibitors under industrial conditions

    • Specificity for target bacteria versus beneficial microorganisms

    • Integration with existing biocide treatments

  • Monitoring Efficacy:

    • Measurement of H₂S production as a primary efficacy indicator

    • Assessment of biofilm formation and corrosion rates

    • Molecular monitoring of DVU_0532 expression levels as a biomarker

Given the regulatory relationship between DVU2956, the Hmc complex, and H₂S production (with DVU2956 reducing H₂S production by approximately 50%), strategies that target this regulatory network show particular promise for industrial applications .

How might comparative analysis of DVU_0532 homologs across different sulfate-reducing bacteria provide insights into evolution of electron transport mechanisms?

Comparative analysis of DVU_0532 homologs across different sulfate-reducing bacteria (SRB) offers valuable insights into the evolution and adaptation of electron transport mechanisms:

  • Evolutionary Conservation and Divergence:

    • DVU_0532 homologs exist in various SRB, such as the 52% amino acid identity with Ddes_1305 in D. desulfuricans

    • Comparative analysis can reveal conserved functional domains versus variable regions that may reflect adaptation to specific ecological niches

    • Phylogenetic analysis of DVU_0532 homologs could track the evolutionary history of this electron transport component across SRB lineages

  • Functional Adaptation:

    • Variations in DVU_0532 sequence across SRB species may correlate with differences in substrate utilization, growth rates, or H₂S production

    • Structural differences might reflect adaptation to different temperature, pH, or salinity conditions

    • Comparative biochemical analysis could reveal how variations in DVU_0532 affect electron transfer efficiency

  • Regulatory Network Evolution:

    • The regulatory relationship between DVU2956 and the Hmc complex in D. vulgaris may have analogs in other SRB

    • Comparing these regulatory networks across species could reveal evolutionary patterns in the coupling of electron transport, H₂S production, and biofilm formation

  • Methodological Approach:

    • Genome mining for DVU_0532 homologs across SRB species

    • Structural modeling to compare key functional domains

    • Heterologous expression studies to assess functional equivalence

    • Complementation assays in DVU_0532 knockout strains

The finding that DVU2956 can inhibit biofilm formation in both D. vulgaris and D. desulfuricans suggests some conservation of regulatory mechanisms across species, providing a starting point for broader comparative studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.