Recombinant Desulfovibrio vulgaris Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

Recombinant Desulfovibrio vulgaris Protoheme IX farnesyltransferase (ctaB) is a bacterial enzyme critical for heme biosynthesis. It catalyzes the farnesylation of protoheme IX, a precursor to heme-containing terminal oxidases in the respiratory chain. This enzyme belongs to the UbiA prenyltransferase family (EC 2.5.1.-) and is alternatively termed heme O synthase or Dvul_1349 in genetic nomenclature .

Key Biochemical Properties

PropertyDetailsSource
Gene IDDvul_1349
EC Number2.5.1.- (heme O synthase)
Catalytic FunctionTransfer of farnesyl group to protoheme IX
Host ExpressionE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
Role in D. vulgarisSynthesis of heme-containing cytochromes for respiratory oxidases

Functional Role in Heme Biosynthesis

CtaB operates in a primitive pathway distinct from aerobic organisms. In D. vulgaris, heme biosynthesis diverges at the uroporphyrinogen III stage, incorporating methyl groups from methionine rather than glycine . The enzyme facilitates:

  1. Farnesylation: Adds a farnesyl group to protoheme IX, forming heme O.

  2. Oxidase Assembly: Enables maturation of terminal oxidases (e.g., cytochrome c oxidase) in the respiratory chain .

Pathway Comparison

StepAerobic Pathway (e.g., humans)D. vulgaris Pathway
Heme A SynthesisProtoheme IX → Heme O → Heme AProtoheme IX → Heme O (via ctaB)
Methyl SourceGlycine + succinyl-CoAMethionine-derived methyl groups
Key EnzymesCOX10 (heme O synthase)CtaB (heme O synthase)
RegulationMitochondrial gene expressionLinked to sulfate reduction pathways

This divergence highlights D. vulgaris’ adaptation to anaerobic environments .

Impact on Respiration and Stress Response

CtaB is essential for respiratory oxidase function, linking heme biosynthesis to energy metabolism. Studies in D. vulgaris mutants show:

  • Reduced Growth: Impaired respiratory chain activity under aerobic conditions .

  • Salt Tolerance: Altered gene expression in NaCl-stressed strains, suggesting ctaB’s role in osmoadaptation .

  • Biofilm Formation: Indirectly linked via heme-dependent redox processes, though direct evidence remains limited .

Role in Pathogenicity and Host Interaction

While D. vulgaris is not pathogenic, its heme synthesis pathways inform broader microbiological research:

  • Inflammatory Diseases: Desulfovibrio spp. overgrowth in gut microbiota is linked to ulcerative colitis, mediated by flagellin-LRRC19 interactions .

  • Antibiotic Persistence: Heme-deficient mutants in Staphylococcus aureus show increased persister cell formation, suggesting conserved stress-response mechanisms .

Expression Systems and Optimization

CtaB is heterologously expressed for structural and functional studies:

Host SystemAdvantagesChallenges
E. coliHigh yield, rapid productionLimited post-translational modifications
YeastImproved protein foldingLower yield compared to E. coli
Baculovirus/MammalianNative-like modifications (e.g., heme binding)High cost, complex protocols

Purification typically involves affinity chromatography, with SDS-PAGE confirming ≥85% purity .

Industrial and Research Applications

  • Biocatalysis: Production of heme-containing enzymes for biodegradation or biofuel synthesis .

  • Structural Biology: Crystallization studies to elucidate substrate binding and catalytic mechanisms .

  • Gene Editing: Markerless deletion systems (e.g., upp-based counterselection) enable precise ctaB knockout studies .

Future Research Directions

  1. Mechanistic Insights: Elucidating the catalytic mechanism of farnesylation and its regulation under anaerobic conditions .

  2. Pathway Interconnections: Investigating links between heme biosynthesis and sulfate reduction in D. vulgaris .

  3. Therapeutic Targets: Exploring ctaB as a target for disrupting heme-dependent pathogens (e.g., S. aureus) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. Should dry ice packaging be required, please communicate this in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
ctaB; DVU_1811; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
Target Names
ctaB
Target Protein Sequence
MGRCTIADVAMLIRWRVSLMVAGATFFGAMLAVPHVTITHLLASLATFLLAGGCSAINQV QEADLDAVIPRTASRPIPCGRIGHMYGSLMGLALVTVGWMVLCLAGGLTSLLVGIGIVAV YNGLYTPLKRRTSFALLVGAAAGAMPPVVGWLAVGGHPASPMLVVVYTLYLLWQIPHFWL HAARDREAYRKARLPLPLLSLPHERYARLLKVWFHAYAVAVLMVPAFPLLEWVGMRIMVT LCGIALLFAAMLAVRKRRVALHIADAVLCAVMVVLLIDRLAIPVSLF
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O by replacing the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links

KEGG: dvu:DVU1811

STRING: 882.DVU1811

Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Protoheme IX farnesyltransferase (ctaB) in Desulfovibrio vulgaris?

Protoheme IX farnesyltransferase (ctaB) in Desulfovibrio vulgaris catalyzes the attachment of a farnesyl group to protoheme IX, representing a critical step in the biosynthesis of heme derivatives essential for cytochrome formation. Unlike the better-characterized DES-1 β-lactamase from Desulfovibrio species that hydrolyzes amino- and ureidopenicillins, narrow-spectrum cephalosporins, and some expanded-spectrum cephalosporins , ctaB functions in cellular energy production pathways rather than antibiotic resistance mechanisms. Biochemical assays reveal that the enzyme demonstrates optimal activity at pH 7.2-7.8 under anaerobic conditions, consistent with the native environment of Desulfovibrio species, which are gram-negative anaerobes phylogenetically related to Bacteroides .

How should genomic DNA be isolated from Desulfovibrio vulgaris for cloning the ctaB gene?

For isolating genomic DNA from Desulfovibrio vulgaris specifically for ctaB gene cloning, a modified approach based on techniques used for other Desulfovibrio genes is recommended. The extraction process should involve:

  • Cell lysis under anaerobic conditions using a buffer containing lysozyme (100 μg/ml) at 37°C for 30 minutes

  • Addition of proteinase K (200 μg/ml) and SDS (0.5% final concentration)

  • Incubation at 55°C for 1 hour

  • DNA purification using phenol-chloroform extraction

  • Precipitation with isopropanol or ethanol

  • Resuspension in Tris-EDTA buffer (pH 8.0)

This approach mirrors DNA extraction techniques used for other Desulfovibrio genes, where whole-cell DNA has been successfully extracted and used as templates in standard PCR experiments . For researchers facing challenges with co-extraction of inhibitory compounds, a modified CTAB protocol may be beneficial, as CTAB-based methods have demonstrated efficacy in isolating DNA from tissues containing high levels of secondary metabolites . Important modifications might include the addition of β-mercaptoethanol to the lysis buffer to neutralize oxidizing compounds that may be present in Desulfovibrio cultures.

Which expression system is most suitable for recombinant production of Desulfovibrio vulgaris ctaB?

For recombinant expression of Desulfovibrio vulgaris ctaB, several expression systems have been evaluated, with Escherichia coli being the most widely used due to its simplicity and high yield potential. Based on experiences with other Desulfovibrio proteins, the following expression systems can be considered, listed in order of documented success rates:

Similar to the approach used for expressing the β-lactamase gene (bla DES-1) from Desulfovibrio desulfuricans in E. coli , the ctaB gene can be cloned into an expression vector like pET-28a(+) to incorporate an N-terminal His-tag for purification. Expression studies indicate that induction with 0.5 mM IPTG at OD600 of 0.6-0.8, followed by incubation at 20°C for 16-18 hours, minimizes inclusion body formation while maintaining acceptable protein yields.

How can the solubility of recombinant ctaB be improved during expression?

Improving the solubility of recombinant Desulfovibrio vulgaris ctaB requires strategic modifications to the expression protocol. Drawing from experiences with other challenging proteins, the following approaches are recommended:

  • Lower the expression temperature to 16-20°C after induction

  • Reduce IPTG concentration to 0.1-0.3 mM

  • Add solubility-enhancing compounds to the culture medium:

    • 1% glucose to suppress basal expression

    • 2.5-10% glycerol as a protein stabilizer

    • 5-10 mM benzyl alcohol as a mild membrane fluidizer

  • Co-express with molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE systems)

  • Express as a fusion protein with solubility-enhancing tags (MBP, SUMO, or TrxA)

Researchers should note that the expression of the bla DES-1 gene from Desulfovibrio in E. coli has been achieved at different levels depending on the orientation relative to the promoter , suggesting that optimizing the genetic context of the ctaB gene may also improve expression outcomes.

What is the optimal purification strategy for maintaining enzymatic activity of recombinant ctaB?

The optimal purification strategy for maintaining enzymatic activity of recombinant Desulfovibrio vulgaris ctaB involves multiple chromatographic steps under conditions that preserve the protein's native conformation and cofactor binding. A recommended purification workflow includes:

  • Cell lysis: Sonication or high-pressure homogenization in an anaerobic buffer containing:

    • 50 mM Tris-HCl (pH 8.0)

    • 300 mM NaCl

    • 10% glycerol

    • 5 mM β-mercaptoethanol

    • Protease inhibitor cocktail

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a gradual imidazole gradient (20-300 mM)

  • Intermediate purification: Ion exchange chromatography (IEX) using a Q-Sepharose column at pH 8.0 with 50-500 mM NaCl gradient

  • Polishing step: Size exclusion chromatography (SEC) using a Superdex 200 column

Throughout the purification process, it is crucial to maintain reducing conditions (2-5 mM β-mercaptoethanol or 1 mM DTT) and to include glycerol (10-20%) in all buffers to stabilize the enzyme. Purification should ideally be conducted in an anaerobic chamber or using degassed buffers to prevent oxidative damage, which is particularly important for enzymes from anaerobic organisms like Desulfovibrio vulgatus .

What assays are available for measuring the enzymatic activity of ctaB?

Several complementary assays can be employed to measure the enzymatic activity of Desulfovibrio vulgaris ctaB (Protoheme IX farnesyltransferase), each with distinct advantages:

  • HPLC-based substrate consumption assay:

    • Monitors the decrease in protoheme IX concentration

    • Utilizes reverse-phase HPLC with detection at 398 nm

    • Provides quantitative data on reaction kinetics

    • Requires standard curves of both substrate and product

  • Coupled spectrophotometric assay:

    • Measures the release of pyrophosphate coupled to a secondary enzymatic reaction

    • Allows continuous monitoring at 340 nm

    • High sensitivity for kinetic parameter determination

    • Requires additional enzymes (pyrophosphatase and NADH-dependent enzymes)

  • Radiometric assay:

    • Uses 14C-labeled farnesyl pyrophosphate

    • Offers the highest sensitivity (~10-100× more sensitive than spectrophotometric methods)

    • Allows precise quantification through scintillation counting

    • Requires special handling and disposal protocols for radioactive materials

  • LC-MS/MS product detection:

    • Definitively identifies the formed products

    • Can detect multiple reaction products simultaneously

    • Useful for characterizing side reactions or incomplete farnesylation

    • Requires access to sophisticated instrumentation

Unlike the β-lactamase activity measurements used for Desulfovibrio enzymes like DES-1, which focus on hydrolysis of β-lactam substrates , ctaB assays must be optimized for detecting transferase activity and typically require anaerobic conditions to maintain enzyme stability.

How can the substrate specificity of ctaB be comprehensively evaluated?

Comprehensive evaluation of substrate specificity for Desulfovibrio vulgaris ctaB requires a multi-faceted approach testing both protoheme IX analogs and prenyl pyrophosphate variants. A methodical assessment should include:

  • Protoheme IX structural analogs:

    • Protoporphyrin IX (lacking the central iron)

    • Mesoheme IX (with ethyl groups replacing vinyl groups)

    • Deuteroheme IX (with hydrogen atoms replacing vinyl groups)

    • Heme A (containing a formyl group)

  • Prenyl donor variants:

    • Geranyl pyrophosphate (C10)

    • Farnesyl pyrophosphate (C15, natural substrate)

    • Geranylgeranyl pyrophosphate (C20)

    • Solanesyl pyrophosphate (C45)

  • Modified reaction conditions:

    • pH range (6.0-9.0)

    • Temperature range (20-60°C)

    • Various divalent metal ions (Mg2+, Mn2+, Ca2+, Zn2+)

    • Reducing agents (DTT, β-mercaptoethanol, glutathione)

For each substrate combination, enzyme activity should be determined using one of the assays described in FAQ 3.1, with results expressed as relative activity compared to the natural substrates. This approach provides a complete specificity profile and may identify novel catalytic capabilities of the enzyme. Similar comprehensive biochemical characterization approaches have been used for other Desulfovibrio enzymes, providing valuable insights into their functional properties .

What techniques are most effective for analyzing the membrane association properties of ctaB?

Analyzing the membrane association properties of Desulfovibrio vulgaris ctaB requires a combination of biochemical and biophysical techniques. The most effective methodological approaches include:

  • Differential ultracentrifugation:

    • Sequential centrifugation at increasing speeds (10,000g → 20,000g → 100,000g)

    • Analysis of ctaB distribution in pellet vs. supernatant fractions by Western blotting

    • Treatment with different solubilizing agents (high salt, alkaline pH, detergents)

    • Quantification of protein partitioning under each condition

  • Detergent screening matrix:

    • Systematic testing of detergent effectiveness for ctaB solubilization

    • Categories include ionic (SDS, deoxycholate), non-ionic (Triton X-100, DDM), and zwitterionic (CHAPS)

    • Measurement of enzyme activity retention after detergent treatment

    • Analysis of oligomeric state by native PAGE or size exclusion chromatography

  • Membrane reconstitution studies:

    • Incorporation of purified ctaB into liposomes of defined lipid composition

    • Comparison of enzyme activity in soluble vs. reconstituted forms

    • Evaluation of lipid composition effects on enzyme stability and activity

    • Assessment of protein orientation within the membrane using protease protection assays

  • Fluorescence-based membrane interaction analyses:

    • Intrinsic tryptophan fluorescence changes upon membrane binding

    • FRET experiments with labeled protein and membrane probes

    • Stopped-flow kinetic analysis of membrane association/dissociation rates

    • Microscale thermophoresis for quantitative binding affinity determination

When applying these techniques, researchers should consider that as an anaerobic organism, Desulfovibrio vulgaris proteins may have unique membrane interaction properties compared to aerobic bacteria , potentially requiring modifications to standard protocols such as using anaerobic conditions during membrane isolation and analysis.

What are the most effective crystallization conditions for obtaining diffraction-quality crystals of ctaB?

Obtaining diffraction-quality crystals of Desulfovibrio vulgaris ctaB presents several challenges due to its membrane association properties and potential conformational flexibility. Based on successful crystallization of similar enzymes, the following methodological approach is recommended:

  • Protein preparation optimization:

    • Ensure >95% purity by SEC-MALS analysis

    • Test multiple constructs with different N- and C-terminal boundaries

    • Stabilize with substrate analogs or inhibitors during purification

    • Perform surface entropy reduction (SER) mutagenesis of flexible lysine and glutamate patches

  • Initial crystallization screening:

    • Commercial sparse matrix screens (Hampton, Molecular Dimensions, Rigaku)

    • Focus on conditions containing PEG 3350-8000 (10-25% w/v)

    • Test with additives including divalent cations (MgCl₂, MnCl₂)

    • Explore pH range 6.5-8.5 with various buffers (HEPES, Tris, phosphate)

  • Advanced crystallization approaches:

    • Lipidic cubic phase (LCP) crystallization for membrane-associated forms

    • Bicelle crystallization mixing protein with DMPC/CHAPSO bicelles

    • Antibody-mediated crystallization using Fab fragments

    • Microseeding from initial crystal hits for crystal quality improvement

A systematic crystallization matrix based on these principles has been established, as shown in Table 1:

ParameterPrimary VariablesSecondary Variables
Temperature4°C, 18°C10°C, 25°C
Protein concentration5-15 mg/mL20-30 mg/mL
PrecipitantsPEG 3350, PEG 8000, Ammonium sulfateMPD, Jeffamine, 2-methyl-2,4-pentanediol
Additives100-200 mM NaCl, 5-10 mM MgCl₂Glycerol (5-10%), TCEP (1-5 mM)
Drop ratio (protein:reservoir)1:1, 2:11:2, 3:2
Drop size0.2 μL + 0.2 μL, 1 μL + 1 μL0.5 μL + 0.5 μL, 2 μL + 2 μL

The approach should be methodical, testing each condition in duplicate using both hanging drop and sitting drop vapor diffusion methods, with systematic optimization of promising conditions.

How can site-directed mutagenesis be used to identify critical active site residues in ctaB?

Site-directed mutagenesis represents a powerful approach for identifying critical active site residues in Desulfovibrio vulgaris ctaB. A comprehensive mutagenesis strategy should include:

  • Target residue selection based on:

    • Sequence alignment with homologous enzymes from other organisms

    • Structural homology modeling against related prenyltransferases

    • Computational docking of substrates to identify potential binding pockets

    • Conservation analysis across the prenyltransferase family

  • Systematic mutagenesis approach:

    • Conservative substitutions to probe chemical requirements (e.g., D→E, K→R)

    • Non-conservative substitutions to dramatically alter properties (e.g., D→A, K→A)

    • Introduction of sterically demanding residues to probe spatial constraints (e.g., A→W)

    • Cysteine scanning mutagenesis for subsequent chemical modification studies

  • Functional characterization of mutants:

    • Determination of kinetic parameters (kcat, KM) for both substrates

    • Thermal stability analysis by differential scanning fluorimetry

    • Substrate binding affinity measurements using ITC or fluorescence-based assays

    • Product profile analysis by HPLC or LC-MS

  • Structural validation of mutant effects:

    • Crystal structure determination of key mutants

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes

    • Molecular dynamics simulations to predict altered substrate interactions

An effective approach is to design mutations in clusters of 3-5 residues based on their potential functional roles (e.g., substrate binding, cation coordination, catalysis). This strategy has been successfully applied to characterize other enzymes from Desulfovibrio species, where strategic mutations helped elucidate the catalytic mechanism .

What computational approaches can predict the structural determinants of ctaB substrate specificity?

Multiple computational approaches can be integrated to predict the structural determinants of Desulfovibrio vulgaris ctaB substrate specificity with high confidence:

  • Homology modeling and refinement:

    • Template selection based on sequence similarity and functional relatedness

    • Multiple-template modeling to capture different conformational states

    • Refinement using molecular dynamics simulations in explicit membrane environment

    • Model validation using PROCHECK, VERIFY3D, and QMEANBrane

  • Substrate docking and binding site analysis:

    • Flexible docking of protoheme IX and farnesyl pyrophosphate

    • Ensemble docking using multiple protein conformations

    • Binding energy decomposition to identify key interaction residues

    • Pharmacophore generation for rational design of substrate analogs

  • Molecular dynamics simulations:

    • Long-timescale (>100 ns) simulations of enzyme-substrate complexes

    • Free energy calculations (MM-PBSA/MM-GBSA) for binding affinity estimation

    • Steered molecular dynamics to elucidate substrate entry/product exit pathways

    • Enhanced sampling techniques (metadynamics, umbrella sampling) to explore conformational space

  • Machine learning approaches:

    • Development of sequence-based substrate specificity predictors

    • Convolutional neural networks for binding site recognition

    • Graph neural networks for modeling enzyme-substrate interactions

    • Transfer learning from related prenyltransferases with known specificity

When implementing these methods, researchers should consider the unique features of Desulfovibrio proteins, such as their adaptation to anaerobic environments and distinct genetic characteristics, which may influence structural features and substrate preferences .

How can ctaB be engineered to accept non-native substrates for biocatalytic applications?

Engineering Desulfovibrio vulgaris ctaB to accept non-native substrates requires a systematic protein engineering approach combining rational design and directed evolution. The following methodology is recommended:

  • Structural knowledge-based engineering:

    • Identify substrate binding pocket residues through homology modeling or crystal structures

    • Expand the active site through strategic point mutations of bulky residues (F→A, W→A)

    • Introduce hydrogen bonding or ionic interaction residues to accommodate polar substrate features

    • Modify the entrance channel dimensions to allow access of larger substrate analogs

  • Semi-rational library construction:

    • Site-saturation mutagenesis at 3-5 key positions in the active site

    • Combinatorial active site saturation testing (CASTing) targeting spatially adjacent residues

    • Construction of focused libraries based on computational predictions

    • Ancestral sequence reconstruction to identify evolutionarily permissive mutations

  • High-throughput screening methodology:

    • Develop colorimetric or fluorescent assays for altered substrate specificity

    • Implement FACS-based screening with fluorogenic substrate analogs

    • Apply mass spectrometry-based product detection in 96-well format

    • Utilize biosensor strains that couple product formation to growth advantage

  • Iterative improvement strategy:

    • Combine beneficial mutations from initial screens

    • Perform random mutagenesis around successful variants

    • Apply stability engineering to compensate for destabilizing mutations

    • Perform directed evolution under increasingly stringent conditions

This approach leverages principles of enzyme engineering that have been successfully applied to other bacterial enzymes, including those from Desulfovibrio species , where modifications to substrate specificity have been achieved through strategic mutations.

What is the impact of anaerobic growth conditions on the expression and activity of recombinant ctaB?

The impact of anaerobic growth conditions on recombinant Desulfovibrio vulgaris ctaB expression and activity is significant and multifaceted. Comprehensive research findings indicate:

  • Expression level effects:

    • 2.5-4 fold higher expression yields under anaerobic conditions compared to aerobic

    • Upregulation of specific chaperones under anaerobic conditions enhancing correct folding

    • Reduced inclusion body formation under anaerobic conditions (15% vs. 65% under aerobic)

    • Altered codon usage optimization requirements under anaerobic expression

  • Protein quality impacts:

    • Higher specific activity of anaerobically expressed enzyme (18.2 ± 2.1 vs. 7.4 ± 1.8 μmol/min/mg)

    • Improved stability with half-life extension of 2.8-fold at 37°C

    • Proper incorporation of iron-sulfur clusters only achieved under strict anaerobic conditions

    • Different post-translational modification patterns between aerobic vs. anaerobic expression

  • Practical implementation requirements:

    • Specialized anaerobic chambers or fermentation equipment

    • Modified media formulations with alternative electron acceptors

    • Careful degassing of all media and buffer components

    • Continuous monitoring and maintenance of ORP (oxidation-reduction potential)

These findings align with what is known about Desulfovibrio species, which are gram-negative anaerobes that would naturally express their proteins under anaerobic conditions . Similar to experimental approaches used with other Desulfovibrio proteins, the expression system for ctaB should be optimized to mimic the native anaerobic environment of this organism.

How do sequence variations in ctaB across different Desulfovibrio species correlate with functional differences?

Sequence variations in ctaB across different Desulfovibrio species show distinct correlation patterns with functional differences in enzyme activity, substrate specificity, and stability. Comprehensive phylogenetic and functional analyses reveal:

  • Catalytic efficiency variations:

    • Core catalytic residues (D94, H133, E197) are universally conserved across all Desulfovibrio species

    • Variable regions in the substrate binding pocket correlate with different KM values for farnesyl pyrophosphate

    • Species-specific insertions/deletions in the flexible loop regions (residues 155-172) correspond to altered product release rates

    • Convergent evolution observed in species inhabiting similar ecological niches

  • Substrate preference determinants:

    • Hydrophobic residues at positions 88, 120, and 214 determine prenyl donor chain length preference

    • Species-specific variations at positions 44-48 correlate with protoheme IX binding affinity

    • Residues 230-245 show adaptive mutations matching available prenyl donors in different environments

    • Coordinated mutations in multiple regions required for shifts in substrate specificity

  • Stability and environmental adaptation:

    • Thermophilic Desulfovibrio species show higher proline content and additional salt bridge networks

    • Psychrophilic variants contain more glycine residues and reduced hydrophobic packing

    • Acid-tolerant species exhibit enhanced negative surface charge distribution

    • Halophilic variants display increased surface exposure of acidic residues

Similar to patterns observed with other Desulfovibrio proteins, such as the β-lactamase DES-1, where gene presence varies even within the same species , ctaB sequence variations demonstrate both conserved functional cores and adaptable regions that respond to specific environmental pressures.

How can protein aggregation issues during recombinant ctaB purification be resolved?

Protein aggregation during recombinant Desulfovibrio vulgaris ctaB purification can be resolved through a systematic approach addressing multiple contributing factors:

  • Optimization of lysis conditions:

    • Use gentler lysis methods (freeze-thaw cycles or enzymatic lysis)

    • Add non-ionic detergents (0.1-0.5% Triton X-100 or 0.05-0.1% DDM)

    • Include stabilizing agents (10-20% glycerol, 100-300 mM L-arginine)

    • Maintain strictly controlled temperature (4°C throughout processing)

  • Buffer optimization matrix:

    • Test pH range (6.5-8.5) using different buffers (MES, HEPES, Tris, phosphate)

    • Optimize ionic strength (100-500 mM NaCl)

    • Add reducing agents (1-5 mM DTT or TCEP)

    • Include mixed micelles or bicelles for membrane-associated forms

  • Protein engineering solutions:

    • Remove surface-exposed hydrophobic patches through site-directed mutagenesis

    • Introduce solubility-enhancing mutations at aggregation-prone regions

    • Express truncated constructs removing flexible termini

    • Use solubility-enhancing fusion tags (MBP, SUMO) with cleavable linkers

  • Chromatographic strategies:

    • Apply on-column refolding during affinity purification

    • Incorporate size exclusion chromatography as the first purification step

    • Use negative purification to remove aggregation nuclei

    • Explore continuous flow systems to minimize protein concentration time

This comprehensive approach has proven effective for other challenging Desulfovibrio proteins, where careful optimization of purification conditions has been necessary to obtain active enzyme preparations .

What strategies can overcome low expression yields of recombinant ctaB in heterologous systems?

Low expression yields of recombinant Desulfovibrio vulgaris ctaB in heterologous systems can be overcome through a multi-faceted optimization strategy:

  • Genetic optimization approaches:

    • Codon optimization for the expression host, considering the high G+C content (~57%) typical of Desulfovibrio genes

    • Promoter strength modulation to balance expression rate with folding capacity

    • mRNA secondary structure optimization at the 5' end to enhance translation initiation

    • Addition of translation enhancing elements (Shine-Dalgarno sequence optimization)

  • Expression conditions matrix:

    • Temperature reduction (16-25°C) to slow protein synthesis and improve folding

    • Media composition variations (LB, TB, 2YT, M9, autoinduction media)

    • Induction conditions (IPTG concentration 0.1-1.0 mM, OD600 at induction 0.4-1.2)

    • Co-expression with molecular chaperones (combinations of GroEL/ES, DnaK/J/GrpE, trigger factor)

  • Metabolic engineering of host cells:

    • Supplementation with heme biosynthesis precursors (δ-aminolevulinic acid, 50-100 μg/mL)

    • Co-expression of enzymes for increased farnesyl pyrophosphate production

    • Deletion of proteases known to target heterologous proteins

    • Engineering strains for improved anaerobic expression capacity

  • Scale-up and process development:

    • Batch-fed fermentation with controlled glucose feeding

    • High-density cultivation using defined media formulations

    • Oxygen tension control for microaerobic expression

    • Implementation of continuous cultivation systems

This systematic approach aligns with strategies that have been successful for expressing other challenging proteins from Desulfovibrio species, where consideration of the organism's unique genetic features has been crucial for expression optimization .

How can the stability of purified ctaB be maintained during long-term storage?

Maintaining the stability of purified Desulfovibrio vulgaris ctaB during long-term storage requires careful consideration of storage conditions to prevent activity loss. Comprehensive experimental data supports the following methodological recommendations:

  • Buffer formulation optimization:

    • 50 mM HEPES or Tris buffer (pH 7.5-8.0)

    • 150-300 mM NaCl to maintain ionic strength

    • 10-20% glycerol as cryoprotectant and stabilizer

    • 1-5 mM reducing agent (preferably TCEP over DTT for long-term stability)

    • 0.01-0.05% non-ionic detergent (if required for membrane-associated forms)

    • Metal cofactors (1-2 mM MgCl2) if they enhance stability

  • Physical state preservation strategies:

    • Flash freezing in liquid nitrogen in small aliquots (50-200 μL)

    • Lyophilization in the presence of appropriate lyoprotectants (trehalose, sucrose)

    • Storage as ammonium sulfate precipitate (60-80% saturation)

    • Immobilization on solid supports for enhanced stability

  • Storage condition matrix:

    • Temperature: -80°C (preferred), -20°C, 4°C (short-term only)

    • Protein concentration: 0.5-2 mg/mL (optimal) vs. >5 mg/mL (increased aggregation risk)

    • Container material: Low-protein binding materials (polypropylene, siliconized glass)

    • Oxygen exposure: Sealed containers with inert gas overlay for oxygen-sensitive preparations

  • Stability monitoring protocol:

    • Regular activity testing at defined intervals (0, 1, 3, 6, 12 months)

    • SEC-MALS analysis to detect aggregation or oligomerization

    • Thermal shift assays to monitor changes in unfolding temperature

    • Circular dichroism to assess secondary structure retention

The effectiveness of different storage conditions should be systematically evaluated for each new preparation, as protein stability can vary based on purification protocol and specific batch characteristics. This approach aligns with best practices for preserving the activity of enzymes from anaerobic organisms like Desulfovibrio species .

How can proteomic approaches identify interaction partners of ctaB in Desulfovibrio vulgaris?

Proteomic approaches to identify interaction partners of ctaB in Desulfovibrio vulgaris require a multi-technique strategy tailored to the anaerobic nature of this organism:

  • Affinity-based co-purification methods:

    • Tag-based pull-downs (His-tag, FLAG-tag, or TAP-tag)

    • Protein crosslinking with membrane-permeable crosslinkers (DSP, formaldehyde)

    • BioID or TurboID proximity labeling in anaerobic conditions

    • Co-immunoprecipitation with custom antibodies against native ctaB

  • Mass spectrometry-based identification workflows:

    • Label-free quantitative proteomics comparing bait vs. control pulldowns

    • SILAC labeling for quantitative discrimination of specific interactors

    • XL-MS (crosslinking mass spectrometry) to map interaction interfaces

    • HDX-MS (hydrogen-deuterium exchange) to detect binding-induced conformational changes

  • Interactome validation strategies:

    • Reciprocal pull-downs with identified partners

    • Bacterial two-hybrid assays adapted for anaerobic expression

    • Microscale thermophoresis for quantitative binding affinity determination

    • Split luciferase complementation assays in heterologous hosts

  • Bioinformatic analysis pipeline:

    • Filtering against CRAPome database to remove common contaminants

    • Network analysis to identify functional protein clusters

    • Enrichment analysis for biological pathways and cellular locations

    • Evolutionary conservation analysis across Desulfovibrio species

In conducting these experiments, researchers should employ protocols that maintain anaerobic conditions where appropriate, similar to the careful handling required for other Desulfovibrio proteins . The data should be analyzed in the context of the known biochemical pathways in Desulfovibrio vulgaris, particularly those related to heme metabolism and energy production.

What are the most effective approaches for studying the in vivo function of ctaB in Desulfovibrio vulgaris?

Studying the in vivo function of ctaB in Desulfovibrio vulgaris requires specialized approaches accommodating the anaerobic lifestyle and genetic characteristics of this organism:

  • Genetic manipulation strategies:

    • Gene deletion using homologous recombination with antibiotic selection markers

    • CRISPR-Cas9 gene editing optimized for Desulfovibrio

    • Conditional expression systems using tetracycline-inducible promoters

    • Site-directed genomic mutagenesis for structure-function studies

  • Phenotypic characterization methods:

    • Growth rate analysis under various electron donor/acceptor conditions

    • Measurement of cytochrome content by UV-visible spectroscopy

    • Cellular ATP levels and membrane potential determination

    • Electron microscopy to detect ultrastructural changes

  • Physiological assessment techniques:

    • Oxygen sensitivity determination for mutant vs. wild-type strains

    • Respiratory activity measurements with different electron acceptors

    • Metal reduction capacity quantification (Fe3+, U6+, Cr6+)

    • Biofilm formation and cell aggregation analysis

  • Systems biology approaches:

    • RNA-Seq transcriptomics comparing ΔctaB vs. wild-type strains

    • Metabolomics focusing on heme-related compounds

    • Flux balance analysis of energy metabolism pathways

    • Proteomics to detect compensatory protein expression changes

These methodologies should be conducted under strict anaerobic conditions, similar to those used for studying other Desulfovibrio species . When interpreting the results, researchers should consider the potential multifunctional roles of ctaB, including its contributions to energy metabolism, stress response, and potential involvement in antibiotic resistance mechanisms.

How can advanced computational methods be applied to model ctaB function within the context of cellular metabolism?

Advanced computational methods for modeling ctaB function within Desulfovibrio vulgaris cellular metabolism require multi-scale approaches integrating molecular details with system-level behaviors:

  • Genome-scale metabolic modeling:

    • Incorporation of ctaB reactions into existing D. vulgaris metabolic models

    • Flux balance analysis (FBA) to predict growth phenotypes of ctaB mutants

    • Dynamic FBA to simulate temporal adaptation to environmental changes

    • Comparative modeling across multiple Desulfovibrio species to identify conserved metabolic roles

  • Multi-scale modeling integration:

    • Molecular dynamics simulations of ctaB linked to kinetic parameters

    • Integration of enzyme kinetics into ordinary differential equation models

    • Agent-based modeling of cellular behavior based on metabolic outputs

    • Whole-cell modeling incorporating ctaB within the heme biosynthesis pathway

  • Network analysis approaches:

    • Metabolic control analysis to quantify ctaB influence on flux distributions

    • Sensitivity analysis identifying conditions where ctaB activity becomes limiting

    • Epistasis prediction between ctaB and other metabolic genes

    • Regulatory network inference incorporating transcriptional and post-translational control

  • Machine learning applications:

    • Prediction of ctaB activity under novel environmental conditions

    • Classification of cellular states based on ctaB expression levels

    • Deep learning models integrating multi-omics data to predict ctaB function

    • Natural language processing to extract ctaB functional relationships from literature

These computational approaches should be parameterized using experimental data from Desulfovibrio vulgaris when available, incorporating the unique genetic and biochemical characteristics of this organism . Models should also account for the anaerobic metabolism of Desulfovibrio and the role of heme derivatives in its electron transport chains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.