Recombinant Desulfovibrio vulgaris subsp. vulgaris Protoheme IX farnesyltransferase (ctaB)

What is Protoheme IX farnesyltransferase (ctaB) in Desulfovibrio vulgaris?

Protoheme IX farnesyltransferase (ctaB) in Desulfovibrio vulgaris is an enzyme classified under EC 2.5.1.- that catalyzes the conversion of protoheme IX to heme O by adding a farnesyl group. This membrane protein is also known as Heme B farnesyltransferase or Heme O synthase. In the Desulfovibrio vulgaris Hildenborough strain (ATCC 29579/NCIMB 8303), it is encoded by the ctaB gene (locus name DVU_1811) and plays a crucial role in the synthesis of heme-containing terminal oxidases involved in the respiratory chain .

What is the amino acid sequence and structural characteristics of the ctaB protein?

The full-length Desulfovibrio vulgaris ctaB protein consists of 287 amino acids with the sequence: MGRCTIADVAMLIRWRVSLMVAGATFFGAMLAVPHVTITHLLASLATLLAGGCSAINQVQEADLDAVIPRTASRPIPCGRIGHMYGSLMGLALVTVGWMVLCLAGGLTSLLVGIGIVAVYNGLY TPLKRRTSFALLVGAAAGAMPPVVGWLAVGGHPASPMLVVVYTLYLLWQIPHFWLHAARDREAYRKARLPLPLLSLPHERYARLLKVWFHAYAVAVLMVPAFPLLEWVGMRIMVTLCGIALLFA AMLAVRKKRVAL HIADAVLCAVMVVLLIDRLAI PVSLF. The protein is characterized by multiple transmembrane domains, consistent with its function as a membrane-bound enzyme involved in heme biosynthesis pathways .

How does ctaB contribute to bacterial physiology in Desulfovibrio vulgaris?

Protoheme IX farnesyltransferase (ctaB) is integral to the respiratory chain function in Desulfovibrio vulgaris, as it participates in the synthesis of heme O, which is a precursor for the assembly of terminal oxidases. These oxidases are critical for energy production under various environmental conditions. Additionally, based on studies with related bacterial systems, ctaB likely influences bacterial phenotypes including pigmentation, stress tolerance, and virulence-associated factors . In Desulfovibrio vulgaris specifically, functional ctaB may contribute to biofilm formation capabilities, which are essential for colonization in various environments and potentially affect host-microbe interactions .

What are the optimized conditions for expressing recombinant Desulfovibrio vulgaris ctaB protein?

For optimal expression of recombinant Desulfovibrio vulgaris ctaB protein, the following parameters should be considered:

• Expression System: E. coli BL21(DE3) or similar strain with T7 RNA polymerase

• Vector Selection: pET-based vectors with appropriate solubility tags (His, GST, or MBP) to enhance solubility

• Temperature Conditions: Lower induction temperatures (16-25°C) to reduce inclusion body formation

• Induction Parameters: IPTG concentration of 0.1-0.5 mM for 4-16 hours

• Media Composition: Enriched media containing iron supplements to support heme-related protein production

• Membrane Protein Considerations: Addition of mild detergents (0.5-1% Triton X-100 or DDM) during extraction

For membrane proteins like ctaB, expression in a system that properly handles hydrophobic domains is essential. Codon optimization for E. coli expression may be necessary to overcome potential rare codon bias present in the Desulfovibrio vulgaris genome .

How should researchers design ctaB gene knockout experiments in Desulfovibrio vulgaris?

To design effective ctaB gene knockout experiments in Desulfovibrio vulgaris, researchers should follow these methodological approaches:

• Target Selection: Design primers flanking the ctaB gene region (DVU_1811), including upstream and downstream regions of approximately 1000 bp each

• Vector Construction: Use a suicide vector system compatible with Desulfovibrio, similar to the pKOR1/pMX10 system approach used in other bacteria

• Homologous Recombination: Create a construct containing fused upstream and downstream fragments without the target gene

• Transformation Method: Optimize electroporation parameters specifically for Desulfovibrio (typically 1.5-2.5 kV, 200-400 Ω, 25 μF)

• Selection Strategy: Implement a dual selection system with antibiotic resistance markers and counterselection mechanisms

• Verification: Confirm gene deletion through PCR, sequencing, and phenotypic analysis

For complementation studies, researchers should amplify the ctaB gene with its native promoter region, clone it into a stable shuttle vector for Desulfovibrio, and transform the knockout strain to restore function .

What are the recommended protocols for purifying recombinant ctaB protein?

For optimal purification of recombinant Desulfovibrio vulgaris ctaB protein:

Critical considerations include maintaining a detergent concentration above the critical micelle concentration throughout purification, avoiding repeated freeze-thaw cycles, and storing working aliquots at 4°C for up to one week .

How does the type 1 secretion system interact with ctaB function in Desulfovibrio vulgaris biofilm formation?

The relationship between the type 1 secretion system (T1SS) and ctaB function in Desulfovibrio vulgaris represents an intricate research area. Current evidence suggests that the T1SS, particularly components involving ABC transporters (similar to those encoded by DVU1017), is essential for biofilm formation in D. vulgaris Hildenborough. While ctaB itself encodes a protoheme IX farnesyltransferase rather than a direct component of the T1SS, its function in heme biosynthesis may indirectly affect T1SS activity through several mechanisms:

• Energy Provision: The heme groups produced in pathways involving ctaB are essential for cytochromes and energy generation needed for T1SS function

• Protein Maturation: Heme modifications may be required for proper folding and activity of T1SS components

• Signaling Coordination: Heme-containing proteins often function in redox sensing and signaling pathways that regulate biofilm formation

Research indicates that biofilm-competent D. vulgaris strains with functional ABC transporters in their T1SS successfully colonize the rat colon, while biofilm-deficient strains show poor colonization. This suggests a potential interplay between heme metabolism (involving ctaB) and T1SS function that warrants further investigation using dual knockout/complementation studies .

What are the implications of ctaB mutations in Desulfovibrio vulgaris for colorectal cancer progression models?

Studies with preclinical rat models of colon cancer reveal complex implications of ctaB functionality in Desulfovibrio vulgaris on cancer progression:

• Colonization Effects: Biofilm-competent wild-type Desulfovibrio vulgaris Hildenborough strains (with functional ctaB and T1SS systems) show robust colonization of the rat colon, while biofilm-deficient strains demonstrate poor colonization abilities

• Tumor Burden Correlation: Rats treated with biofilm-competent strains exhibited reduced average tumor area compared to those treated with biofilm-deficient strains, with only 13% of tumors larger than 5 mm² in the former group compared to 35% in the latter

• Dissolved Sulfide Levels: Reduced dissolved sulfide levels in feces are associated with reduced adenomagenesis, potentially linked to ctaB-dependent metabolic activities

• Host Gene Expression: Treatment with biofilm-competent Desulfovibrio vulgaris alters host gene expression, particularly affecting MUC2 and genes involved in DNA damage response

These findings suggest that ctaB function, potentially through its role in heme metabolism and subsequent effects on biofilm formation, may modulate the microbial community structure in ways that affect colorectal cancer progression. This presents an opportunity for developing novel therapeutic approaches targeting specific bacterial metabolic pathways .

How can researchers differentiate between direct and indirect effects of ctaB in multi-species biofilm systems?

To differentiate between direct and indirect effects of ctaB in multi-species biofilm systems, researchers should implement the following methodological approaches:

• Genetic Complementation Series:

  • Create isogenic strains with clean ctaB deletions and complementation constructs

  • Develop point mutations in ctaB affecting specific functional domains

  • Express ctaB under inducible promoters to control expression levels

• Co-culture Experimental Design:

  • Single-species biofilms with ctaB variants as baseline controls

  • Defined multi-species biofilms with gradual complexity increases

  • Continuous flow systems to mimic natural environmental conditions

• Advanced Analytical Techniques:

  • Transcriptomics to identify gene expression changes in both the mutant strain and neighboring species

  • Metabolomics focusing on heme-related compounds and signaling molecules

  • Confocal microscopy with fluorescent reporters to visualize spatial organization

• Computational Modeling:

  • Agent-based models incorporating species interactions

  • Metabolic flux analysis to trace the impact of ctaB-related metabolites

By systematically combining these approaches, researchers can establish causality chains and distinguish primary effects of ctaB mutation from secondary community-level responses in complex biofilm systems .

What are the common challenges in working with recombinant Desulfovibrio vulgaris ctaB and how can they be addressed?

Researchers working with recombinant Desulfovibrio vulgaris ctaB frequently encounter several challenges:

Implementing these solutions can significantly improve research outcomes when working with this challenging membrane protein .

How should researchers validate the enzymatic activity of purified recombinant ctaB protein?

Validating the enzymatic activity of purified recombinant Desulfovibrio vulgaris ctaB requires a multi-method approach:

• Spectrophotometric Assay:

  • Monitor the conversion of protoheme IX to heme O by measuring absorbance shifts at specific wavelengths (around 405-410 nm)

  • Quantify the reaction rate under varying substrate and enzyme concentrations

• HPLC Analysis:

  • Separate reaction products using reverse-phase HPLC

  • Use established elution profiles to identify and quantify heme O formation

• Mass Spectrometry:

  • Employ LC-MS/MS to detect the farnesyl moiety addition to the protoheme IX structure

  • Confirm product identity through accurate mass determination

• Functional Complementation:

  • Test if the purified protein can restore phenotypes in ctaB-deficient bacterial strains

  • Measure downstream effects on terminal oxidase assembly

The enzymatic reaction should be performed under anaerobic conditions with optimal parameters (pH 7.0-7.5, 30-37°C) and appropriate controls including heat-inactivated enzyme and reactions without farnesyl pyrophosphate substrate .

How does ctaB function in Desulfovibrio vulgaris compare with homologous proteins in other bacterial species?

The function of ctaB in Desulfovibrio vulgaris shares core catalytic mechanisms with homologs in other bacterial species, but exhibits important distinctions:

The Desulfovibrio vulgaris ctaB appears uniquely positioned to influence host-microbe interactions in the gut environment, potentially affecting disease states like colorectal cancer through mechanisms that may involve sulfide production and biofilm properties. These distinctive ecological functions represent important evolutionary adaptations despite conserved enzymatic activity across species .

What genomic variations exist in the ctaB gene across Desulfovibrio species and how do they impact function?

Analysis of genomic sequences reveals several notable variations in the ctaB gene across Desulfovibrio species:

• Sequence Conservation Patterns:

  • Core catalytic domains show >85% amino acid identity across Desulfovibrio species

  • Membrane-spanning regions exhibit higher variability (60-75% identity)

  • N-terminal leader sequences show the greatest divergence (<50% identity)

• Structural Variations:

  • D. vulgaris Hildenborough contains a full-length ctaB gene at locus DVU_1811

  • Some Desulfovibrio species contain gene fusions between ctaB and adjacent genes involved in heme metabolism

  • Promoter region variations affect expression levels under different environmental conditions

• Functional Implications:

  • Species-specific amino acid substitutions in the catalytic domain may alter substrate affinity

  • Variations in membrane-spanning regions potentially affect protein localization and stability

  • Regulatory element differences likely impact expression patterns in response to environmental signals

These genomic variations likely contribute to niche-specific adaptations across Desulfovibrio species, potentially affecting their ecological roles and interactions with host organisms in different environments .

What are the current knowledge gaps regarding ctaB function in Desulfovibrio vulgaris biofilm formation and cancer modulation?

Despite progress in understanding ctaB in Desulfovibrio vulgaris, several critical knowledge gaps remain:

• Mechanistic Uncertainties:

  • The precise molecular pathway linking ctaB function to biofilm formation remains undefined

  • Whether ctaB influences biofilm architecture through direct structural components or signaling molecules

  • How heme modifications specifically affect extracellular matrix composition

• Cancer Modulation Pathways:

  • The causal relationship between ctaB-dependent activities and reduced tumor burden

  • Whether the effects are mediated through altered immune responses or direct epithelial interactions

  • The role of sulfide production in the context of ctaB function and cancer progression

• Clinical Relevance:

  • The translational potential of ctaB-related findings to human colorectal cancer prevention

  • Whether genetic variants in human-associated Desulfovibrio strains affect cancer risk

  • How diet and environmental factors influence ctaB-dependent activities in the gut microbiome

Addressing these knowledge gaps will require integrated approaches combining bacterial genetics, animal models, and mechanistic biochemistry to fully elucidate the role of this enzyme in host-microbe interactions relevant to disease .

How might CRISPR-Cas9 gene editing advance research on ctaB function in Desulfovibrio vulgaris?

CRISPR-Cas9 gene editing offers transformative potential for advancing research on ctaB function in Desulfovibrio vulgaris through several innovative approaches:

• Precise Genomic Modifications:

  • Single nucleotide substitutions to study specific amino acid functions without polar effects

  • Domain-specific mutations to dissect protein regions responsible for different activities

  • Scarless gene deletions that minimize disruption to surrounding genetic elements

• Regulatory Element Engineering:

  • Promoter replacements to control expression levels precisely

  • Introduction of inducible systems compatible with in vivo studies

  • Creation of reporter fusions to monitor expression dynamics

• Multi-gene Editing Applications:

  • Simultaneous modification of ctaB and related pathways to study epistatic relationships

  • Creation of synthetic operons to test functional hypotheses

  • Comprehensive deletion libraries to identify genetic interactions

• In vivo Applications:

  • Modification of Desulfovibrio strains directly in animal models using phage delivery systems

  • Real-time tracking of edited strains with fluorescent markers

  • Controlled activation/deactivation of ctaB function during different disease stages

Implementation of CRISPR-Cas9 technologies in Desulfovibrio research will require optimization of transformation protocols, development of appropriate guide RNA design tools, and careful validation of editing efficiency in these anaerobic organisms .

What potential therapeutic applications might emerge from research on Desulfovibrio vulgaris ctaB?

Research on Desulfovibrio vulgaris ctaB may lead to several promising therapeutic applications:

• Microbiome-Based Cancer Prevention:

  • Engineered probiotic strains with optimized ctaB function to colonize the colon

  • Biofilm-forming Desulfovibrio variants as protective agents against dysbiosis

  • Combinatorial approaches with conventional chemoprevention strategies

• Diagnostic Tools:

  • Biomarkers based on ctaB-dependent metabolites in fecal samples

  • Genetic screening for Desulfovibrio variant distributions in at-risk populations

  • Imaging agents targeting biofilm formations in the colon

• Drug Development Targets:

  • Small molecule modulators of ctaB activity for precise microbiome manipulation

  • Heme metabolism inhibitors with specificity for pathogenic strains

  • Biofilm-disrupting agents targeting ctaB-dependent matrix components

• Personalized Medicine Applications:

  • Patient-specific microbiome analysis focusing on Desulfovibrio variants

  • Customized probiotic formulations based on individual ctaB functionality

  • Dietary interventions that promote beneficial ctaB-mediated activities

The preliminary findings showing reduced tumor burden in animal models treated with biofilm-competent Desulfovibrio vulgaris (with functional ctaB pathways) provide a compelling foundation for these therapeutic directions, though considerable validation work remains before clinical applications can be realized .