Recombinant Desulfovibrio vulgaris subsp. vulgaris Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cell Wall Biosynthesis

UppP is a key player in the lipid II cycle, recycling UPP to UP after glycan chain polymerization . This activity is critical for maintaining peptidoglycan synthesis rates. In Bacillus subtilis, UppP forms a synthetic lethal pair with BcrC, another UPP phosphatase, ensuring UP availability even under stress . Deletion of uppP in D. vulgaris confers resistance to 5-fluorouracil (5-FU), enabling its use as a counterselectable marker in genetic engineering .

Key Research Findings

  • Genetic Engineering Tool: A ΔuppP strain (JW710) of D. vulgaris was developed for markerless gene deletions. Reintroducing uppP restores 5-FU sensitivity, validating its role in nucleotide salvage pathways .

  • Bacitracin Resistance: UppP competes with bacitracin for UPP binding. Overexpression enhances bacitracin susceptibility, linking UppP activity to antibiotic resistance mechanisms .

  • Pseudohyphae Growth: In yeast systems, constitutive UppP expression indirectly affects pseudohyphae formation by altering metabolic maintenance, impacting recombinant protein yields .

Applications in Biotechnology

Recombinant UppP is utilized in:

  • Antibiotic Research: Studying bacitracin resistance and cell wall biosynthesis pathways .

  • Genetic Systems: Enabling markerless deletions in sulfate-reducing bacteria like D. vulgaris .

  • Enzyme Engineering: Optimizing lipid carrier recycling for synthetic biology applications .

Challenges and Stability

  • Storage Sensitivity: Repeated freeze-thaw cycles degrade activity; glycerol stabilization is recommended .

  • Expression Leakage: Basal uppP expression in ΔuppP strains can complicate counterselection, requiring tightly regulated promoters .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by several factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Dvul_1427; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Desulfovibrio vulgaris subsp. vulgaris (strain DP4)
Target Names
uppP
Target Protein Sequence
MSDMITAAILGLVEGLTEFLPVSSTGHLIITGELLGFTGPKAATFEVAIQLGAILAVVVL YWDRFWGLLRPQPYVRFAGLRGIMLLLLTSLPASVLGLAAHSTIKAHLFTPSTVAIALAV GAIFMLLVERRTERPRYMTLDEMSPALALGIGCFQCLALWPGFSRSAATIMGGMLLGARR GLAAEYSFIAAVPIMFAATGYDLLKSWTLFTPADLPFFATGFVVSFLSAWAAVKLFIALV GRMTFRPFAWYRLAIAPLVYYFMAY
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of Undecaprenyl-diphosphatase (uppP) in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP) plays a critical role in bacterial cell wall synthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This conversion is essential because UP serves as a carrier lipid in the bacterial cell wall biosynthetic pathway. The process begins with farnesyl diphosphate synthase (FPPS) generating farnesyl pyrophosphate (FPP), which then condenses with 8 additional IPP molecules to form C55 undecaprenyl diphosphate (UPP) through a reaction catalyzed by undecaprenyl diphosphate synthase (UPPS). Subsequently, uppP converts UPP to UP, which is then utilized in the peptidoglycan biosynthesis pathway .

Due to its essential function and absence in human cells, uppP represents an attractive target for antibacterial drug development. The enzyme is also known as Bacitracin resistance protein in some literature, indicating its role in antibiotic resistance mechanisms .

What expression systems are commonly used for recombinant production of uppP?

For recombinant expression of Desulfovibrio vulgaris subsp. vulgaris uppP, Escherichia coli is the most commonly utilized expression system. The protein can be expressed with an N-terminal His-tag to facilitate purification. The His-tagged recombinant protein generally maintains its native enzymatic activity while providing the advantage of simplified purification through affinity chromatography .

Alternative methods for membrane protein expression have been developed, including fusion with bacteriorhodopsin tags at the N-terminus of target proteins, which can enhance expression levels and stability. This approach has opened new opportunities for investigating specific amino acids critical to enzymatic catalysis through site-directed mutagenesis .

How can the enzymatic activity of uppP be assayed in vitro?

The enzymatic activity of uppP can be assayed by measuring the dephosphorylation of undecaprenyl pyrophosphate. A typical assay includes:

  • Substrate preparation: Undecaprenyl pyrophosphate can be either purchased commercially or synthesized enzymatically using purified UPPS.

  • Reaction conditions: The standard reaction mixture contains:

    • Purified uppP enzyme (typically 0.1-1.0 μg)

    • Undecaprenyl pyrophosphate substrate (25-100 μM)

    • Buffer: Tris/PBS-based buffer (pH 8.0)

    • Essential divalent cations: MgCl₂ or CaCl₂ (5-10 mM) as uppP has an absolute requirement for magnesium or calcium ions

    • Detergent: A mild detergent such as Triton X-100 (0.1%) to maintain the membrane protein in solution

  • Activity measurement: The reaction can be monitored by:

    • Quantifying released inorganic phosphate using colorimetric methods

    • Using radiolabeled substrates and measuring product formation by thin-layer chromatography

    • Employing coupled enzyme assays that link phosphate release to a spectrophotometrically detectable reaction

What is the optimal procedure for storing and reconstituting recombinant uppP?

Based on manufacturer recommendations for Desulfovibrio vulgaris subsp. vulgaris uppP:

  • Storage conditions:

    • Store lyophilized protein at -20°C or -80°C upon receipt

    • Aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

    • Aliquot the reconstituted protein for storage at -20°C/-80°C

Storage ConditionTemperatureMaximum Duration
Lyophilized powder-20°C/-80°CLong-term
Reconstituted with glycerol-20°C/-80°CLong-term
Working solution4°CUp to one week

How can site-directed mutagenesis be used to identify critical residues in the active site of uppP?

Site-directed mutagenesis is a powerful approach for identifying catalytically important residues in enzymes like uppP. Based on published research on uppP:

  • Target selection: Focus on the two consensus regions containing (E/Q)XXXE and PGXSRSXXT motifs, as well as the conserved histidine residue. Specific residues to target include:

    • E17 and E21 (in the glutamate-rich motif)

    • H30 (conserved histidine)

    • S173, R174, and T178 (in the PGXSRSXXT motif)

  • Mutagenesis protocol:

    • Design primers containing the desired mutations

    • Perform PCR-based mutagenesis using a high-fidelity DNA polymerase

    • Confirm mutations by DNA sequencing

    • Express and purify the mutant proteins using the same conditions as the wild-type

  • Functional analysis: Compare the enzymatic activities of wild-type and mutant proteins. Previous studies have shown that mutations E17A/E21A, H30A, S173A, R174A, and T178A resulted in complete loss of activity, confirming their essential roles in catalysis .

  • Structural implications: Combine mutagenesis results with computational modeling to propose a three-dimensional structure of the catalytic site and understand enzyme-substrate interactions in membrane bilayers.

What computational methods can be applied to predict the three-dimensional structure of uppP?

Since uppP is an integral membrane protein, specialized computational approaches are required for structure prediction:

  • Rosetta membrane ab initio method: This approach can be used to generate a three-dimensional model of uppP using:

    • Predicted transmembrane topology

    • Fragment-based assembly

    • Energy minimization specific for membrane proteins

    • Incorporation of experimental constraints from mutagenesis studies

  • Molecular dynamics simulations: After generating an initial structure, molecular dynamics simulations in explicit lipid bilayers can:

    • Refine the structural model

    • Assess structural stability

    • Study protein-lipid interactions

    • Investigate conformational changes relevant to catalysis

    • Provide insights into the molecular basis of enzyme-substrate interaction in membrane environments

  • Homology modeling: If structural homologs are identified, homology modeling can be employed using:

    • Template identification through sequence similarity searches

    • Alignment of target and template sequences

    • Model building and refinement

    • Validation using energy-based scoring functions

How can experimental design be optimized for studying uppP inhibitors as potential antimicrobial agents?

A systematic experimental design for studying uppP inhibitors should include:

  • Initial screening approach:

    • Develop a high-throughput enzymatic assay using purified recombinant uppP

    • Screen compound libraries to identify hits that inhibit enzymatic activity

    • Confirm hits using concentration-dependent inhibition studies

    • Determine IC₅₀ values for promising compounds

  • Design of control experiments:

    • Include positive controls (known phosphatase inhibitors)

    • Include negative controls (compounds with no expected activity)

    • Test against human phosphatases to assess selectivity

    • Include appropriate vehicle controls

  • Assessment of bactericidal activity:

    • Determine minimum inhibitory concentrations (MICs) against various bacterial species

    • Test for activity against antibiotic-resistant strains

    • Evaluate combinatorial effects with existing antibiotics

    • Assess potential for resistance development through serial passage experiments

  • Mechanism of action studies:

    • Perform enzyme kinetics to determine inhibition mechanism (competitive, non-competitive, etc.)

    • Use site-directed mutagenesis to identify binding sites

    • Employ computational docking to predict binding modes

    • Validate binding interactions through biophysical methods like isothermal titration calorimetry

  • Experimental design table:

PhaseExperimentPurposeControlsAnalysis Method
1In vitro enzyme assayInitial screeningKnown inhibitorsIC₅₀ determination
2Bacterial growth inhibitionAntimicrobial activityStandard antibioticsMIC determination
3Mechanism studiesDetermine mode of actionKinetic controlsLineweaver-Burk plots
4Resistance developmentAssess barrier to resistancePassage with sublethal dosesResistance frequency
5In vivo efficacyTherapeutic potentialStandard antibiotic treatmentSurvival analysis

How can top-down mass spectrometry be applied to analyze recombinant uppP?

Top-down mass spectrometry is a powerful technique for analyzing intact proteins like recombinant uppP. The approach involves:

  • Sample preparation:

    • Purify recombinant uppP to high homogeneity (>90% as determined by SDS-PAGE)

    • Exchange into a mass spectrometry-compatible buffer

    • For membrane proteins like uppP, specialized detergents or nanodiscs may be required to maintain protein solubility

  • Mass spectrometry analysis:

    • Direct analysis of the intact protein

    • Fragmentation of the intact protein using techniques like electron transfer dissociation (ETD) or higher-energy collisional dissociation (HCD)

    • Collection of high-resolution MS and MS/MS spectra

  • Data processing workflow:

    • Deconvolution to determine the monoisotopic mass of the intact protein

    • Deisotoping to simplify complex isotope patterns

    • Searching fragmentation patterns against theoretical digests using specialized software like ProSight Lite

  • Applications:

    • Confirmation of protein sequence and integrity

    • Detection of post-translational modifications

    • Characterization of proteoforms

    • Verification of N-terminal processing

    • Confirmation of His-tag presence and integrity

What approaches can be used to study the membrane topology of uppP?

Understanding the membrane topology of uppP is crucial for elucidating its function. Several complementary approaches can be employed:

These approaches have revealed that the two consensus regions containing (E/Q)XXXE and PGXSRSXXT motifs are localized near the aqueous interface of uppP and oriented toward the periplasmic site, suggesting that the enzyme's catalytic function occurs on the outer side of the plasma membrane .

How can markerless genetic exchange systems be used to study uppP function in Desulfovibrio vulgaris?

Markerless genetic exchange systems offer advantages for studying gene function in bacteria without introducing antibiotic resistance markers. For studying uppP in Desulfovibrio vulgaris:

  • System design:

    • Construct a suicide vector containing:

      • Homologous regions flanking the uppP gene

      • A counter-selectable marker (e.g., sacB gene conferring sucrose sensitivity)

      • A positive selection marker (e.g., antibiotic resistance gene)

  • First crossover event:

    • Transform D. vulgaris with the suicide vector

    • Select transformants using the positive selection marker

    • Verify integration by PCR

  • Second crossover event:

    • Culture the first crossover mutants in media without selection

    • Plate on media containing the counter-selection agent (e.g., sucrose)

    • Screen colonies for loss of the positive selection marker

  • Verification and analysis:

    • Confirm gene deletion or modification by PCR and sequencing

    • Analyze phenotypic changes:

      • Cell wall integrity (osmotic sensitivity)

      • Antibiotic susceptibility (especially to cell wall-targeting antibiotics)

      • Growth characteristics

      • Morphological changes

  • Complementation studies:

    • Reintroduce wild-type or mutant versions of uppP to confirm phenotype specificity

    • Use inducible promoters to control gene expression levels

What strategies can be employed to overcome challenges in expressing active recombinant uppP?

As an integral membrane protein, uppP presents several challenges for recombinant expression. The following strategies can be employed to overcome these challenges:

  • Expression optimization:

    • Test multiple expression systems (E. coli strains, yeast, insect cells)

    • Optimize codon usage for the host organism

    • Use specialized expression vectors with tunable promoters

    • Test different fusion tags (His, GST, MBP, SUMO) for enhanced solubility

    • Utilize bacteriorhodopsin as a fusion tag, which has shown success for membrane proteins

  • Solubilization and stabilization:

    • Screen different detergents for optimal extraction and stability

    • Consider amphipols or nanodiscs for maintaining native-like lipid environments

    • Include stabilizing additives such as glycerol or specific lipids in buffers

    • Test the addition of specific lipids that might be required for activity

  • Functional validation:

    • Develop reliable activity assays that work in detergent-solubilized conditions

    • Consider whole-cell assays if purification affects activity

    • Monitor protein quality by size-exclusion chromatography to assess aggregation

    • Verify proper folding using circular dichroism spectroscopy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.