Recombinant Desulfurispirillum indicum Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Desulfurispirillum indicum Protein Translocase Subunit SecD (SecD) is a genetically engineered protein involved in the bacterial Sec-dependent protein translocation system. This system facilitates the transport of preproteins across the cytoplasmic membrane, a critical process for bacterial survival and environmental adaptation. The recombinant SecD protein is produced using heterologous expression systems such as E. coli, yeast, or mammalian cells, enabling detailed biochemical and functional studies .

Overexpression and Translocation Efficiency

Overexpression of SecD and SecF in E. coli enhances the export of both wild-type and signal sequence-mutant proteins, suggesting a conserved role in optimizing translocation kinetics .

Genetic Knockout Phenotypes

  • secD null mutants exhibit severe cold sensitivity and reduced viability at 37°C, underscoring its essentiality in stress adaptation .

  • Suppressor mutations in secD-deficient strains often restore SecA stability, linking SecD to translocon recycling .

Applications in Biochemical Research

Recombinant Desulfurispirillum indicum SecD is utilized for:

  • Mechanistic Studies: Investigating PMF-driven protein transport using in vitro reconstituted systems .

  • Structural Biology: Crystallization and cryo-EM analyses to map translocon dynamics .

  • Antibiotic Development: Targeting SecD’s role in virulence factor secretion in pathogenic bacteria .

Comparative Analysis with Homologs

FeatureDesulfurispirillum indicum SecDE. coli SecD
Gene LocusSelin_2365b1177 (secD)
EssentialityNon-essential but criticalNon-essential
Cold SensitivityNot explicitly reportedSevere export defects
PMF UtilizationConserved mechanism Well-characterized

Future Directions

Research gaps include resolving the atomic structure of Desulfurispirillum indicum SecD and elucidating its interplay with redox partners in sulfur-metabolizing pathways. Advances in cryo-ET and single-molecule imaging could further decode its role in environmental adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; Selin_2365; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-515
Protein Length
full length protein
Species
Desulfurispirillum indicum (strain ATCC BAA-1389 / S5)
Target Names
secD
Target Protein Sequence
MDGKLIAKLLLIAAVIGFCIHLATPLNEKIALGLDLQGGMHLALDVDTEQAVERKLDAMT NALRLEAQQQHLVIGTIQRRGMQILIPVPYAEEKAEFKRLMQRRYGQLELQDEQPELLVY GYTTYDIEEIKELAVGQALETIRNRIDQFGVSEPTVQKQGDRRIIIELPGVEDVDRAVEL IGRTAMLEFRLVNENVSTRDALDGFLPENSEVLYQRHMDPQTNTEVDRTPFVLYRDVIFT GDRLLDARVRFDPQFNTPYVSITLDGEGARLFADVTGRNVGRRLAIVLDGHVHSAPVINE RIPSGQASISGQFTMEQATDLSIVLRSGSLPAPVDIVENRTVGPTLGQDSIDKGILSVTI GMALVLLFMVAYYRLSGLLANMALLMNLIILMGLLAYFGATLTLPGIAGIILTIGIAVDA NVLIFERIREELRRGASPRLAIEEGYAKAFSTILDANITTLIVAVILFQFGTGPIKGFAV TLSIGILASMFTAILCTRAIYELILVYKPIRKLSI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Desulfurispirillum indicum and what role does its SecD protein play in cellular processes?

Desulfurispirillum indicum is a selenate- and selenite-respiring bacterium isolated from an estuarine canal . It belongs to a group of bacteria involved in the selenium biogeochemical cycle through dissimilatory reduction of selenium oxyanions. The protein translocase subunit SecD (secD) in D. indicum, encoded by the gene Selin_2365, functions as a critical component of the bacterial protein secretion machinery . SecD works cooperatively with other Sec system components to facilitate the translocation of proteins across the cytoplasmic membrane. This process is essential for numerous cellular functions including nutrient acquisition, waste removal, and environmental adaptation mechanisms that support the organism's unique metabolic capabilities in selenium-rich environments.

How does the SecD protein relate to the SecF protein in D. indicum?

In D. indicum, the SecD protein (encoded by Selin_2365) and SecF protein (encoded by Selin_2366) are functionally related components of the bacterial protein translocation machinery . These proteins typically form a complex (SecDF) that enhances the efficiency of protein secretion by utilizing proton motive force to drive protein translocation across the membrane. The proteins work in conjunction with other components of the Sec system, including SecA, SecY, and SecE.

Structurally, while SecD and SecF share some homologous domains, they have distinct functions. Based on amino acid sequence analysis of the SecF protein from D. indicum (314 amino acids in length) , we can infer that SecD likely possesses complementary structural features that facilitate interaction between these two proteins. Their genes are typically located adjacently in the genome (Selin_2365 and Selin_2366), reflecting their functional relationship and possible co-regulation .

What expression systems are most effective for producing recombinant D. indicum SecD protein?

For successful expression of recombinant D. indicum SecD protein, researchers have successfully employed multiple expression systems. According to available data, viable expression hosts include E. coli, yeast, baculovirus, and mammalian cell systems . The selection of an optimal expression system should consider:

  • E. coli systems: Offer rapid growth and high protein yields but may struggle with proper folding of complex membrane proteins like SecD.

  • Yeast systems: Provide a eukaryotic environment with advanced protein folding machinery while maintaining relatively simple cultivation requirements.

  • Baculovirus systems: Excel for larger proteins requiring post-translational modifications.

  • Mammalian cell systems: Offer the most sophisticated folding and processing machinery but at higher cost and complexity.

For membrane proteins like SecD, a methodological approach similar to recombineering techniques using the bacteriophage λ Red system may be beneficial when genetic modifications are required . This approach allows for precise genetic engineering through homologous recombination using short targeting homologies (40-60 bp), which can be particularly valuable when optimizing expression constructs for challenging membrane proteins.

What purification strategies should be employed to obtain high-purity recombinant SecD protein?

Purification of recombinant D. indicum SecD protein to ≥85% purity can be achieved using a systematic approach similar to that employed for other membrane proteins . A recommended purification protocol includes:

  • Cell lysis optimization: Gentle lysis techniques such as osmotic shock or enzymatic methods help preserve membrane protein integrity.

  • Membrane fraction isolation: Through differential centrifugation followed by solubilization using appropriate detergents (typically non-ionic or zwitterionic).

  • Affinity chromatography: Utilizing affinity tags determined during the production process.

  • Size-exclusion chromatography: For separating aggregates and contaminants of different molecular weights.

  • Quality assessment: SDS-PAGE analysis to confirm purity ≥85% as specified in standard preparations .

For storage, purified SecD should be maintained in a Tris-based buffer with 50% glycerol at -20°C, with extended storage at -80°C. Working aliquots can be stored at 4°C for up to one week, with repeated freeze-thaw cycles being explicitly discouraged .

How can researchers investigate the structure-function relationship of SecD protein domains?

Investigating structure-function relationships in D. indicum SecD requires a multifaceted approach:

  • Sequence analysis and domain prediction:

    • Identify conserved domains through alignment with homologous SecD proteins

    • Predict transmembrane segments and periplasmic domains

    • Map key residues potentially involved in proton transport or substrate interaction

  • Site-directed mutagenesis:

    • Target conserved residues using a recombineering approach with the λ Red system

    • Generate point mutations, deletions, or domain swaps

    • The λ Red system allows for precise genetic modifications using short homology regions, which is particularly useful for membrane protein studies

  • Functional assays:

    • Protein translocation efficiency measurements

    • ATPase activity assays of the SecA-SecYEG-SecDF complex

    • Proton transport measurements

  • Structural biology techniques:

    • X-ray crystallography or cryo-EM of the SecDF complex

    • Limited proteolysis to identify domain boundaries

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

How does SecD interact with other components of the Sec translocation machinery?

The SecD protein functions within a complex translocation machinery, interacting with multiple components:

  • SecF interaction: SecD forms a complex with SecF, with their genes (Selin_2365 and Selin_2366) adjacently located in the D. indicum genome . This complex enhances protein translocation efficiency by utilizing the proton motive force.

  • SecYEG interaction: The SecDF complex associates with the core SecYEG translocon to form a holotranslocon. This interaction can be studied using co-immunoprecipitation, cross-linking studies, or fluorescence resonance energy transfer (FRET) assays.

  • SecA interaction: SecA, the motor protein that provides energy through ATP hydrolysis, interacts with the SecYEG-SecDF complex. Researchers can investigate this interaction using ATPase activity assays in the presence or absence of SecDF.

  • Substrate protein interactions: SecD may directly contact substrate proteins during translocation. This can be studied using photocrosslinking with unnatural amino acids incorporated into the substrate proteins or SecD itself.

How can researchers utilize recombinant D. indicum SecD in studying bacterial protein secretion mechanisms?

Recombinant D. indicum SecD provides a valuable tool for investigating bacterial protein secretion through several methodological approaches:

  • Reconstitution studies:

    • Purified SecD can be reconstituted with other Sec components in liposomes

    • This allows measurement of translocation efficiency under controlled conditions

    • Parameters such as lipid composition, pH, and ionic strength can be systematically varied

  • Comparative analysis across species:

    • D. indicum SecD can be compared with homologs from other bacteria

    • This approach reveals evolutionary conservation and specialization

    • Functional complementation studies in SecD-deficient strains can assess interspecies compatibility

  • Drug development applications:

    • The Sec system represents a potential antibacterial target

    • SecD inhibitors could be screened using reconstituted systems

    • Structure-based drug design approaches become possible with structural data

  • Biotechnological applications:

    • Enhanced understanding of SecD function can improve protein secretion systems

    • Engineered SecD variants might enhance production of difficult-to-express proteins

    • Integration with heterologous expression systems could optimize industrial protein production

What methodological approaches are effective for analyzing SecD-mediated protein translocation kinetics?

Researchers investigating the kinetics of SecD-mediated protein translocation can employ several complementary methodologies:

  • Real-time fluorescence assays:

    • Fluorescently labeled substrate proteins allow monitoring of translocation events

    • FRET-based approaches detect substrate-translocon interactions

    • Single-molecule techniques reveal individual translocation steps

  • Protease protection assays:

    • Differential protease sensitivity distinguishes between cytoplasmic, membrane-embedded, and translocated protein segments

    • Time-course experiments reveal translocation intermediates

    • Quantitative analysis yields translocation rate constants

  • Electrophysiological approaches:

    • SecYEG-SecDF complexes reconstituted in planar lipid bilayers

    • Patch-clamp recordings detect ion flows associated with protein translocation

    • Channel opening/closing events correspond to different translocation states

  • Computational modeling:

    • Molecular dynamics simulations predict SecD conformational changes

    • Kinetic models integrate experimental data to predict rate-limiting steps

    • Systems biology approaches model the complete translocation process

What is the relationship between SecD function and selenium metabolism in D. indicum?

D. indicum is known for its selenium oxyanion respiration capabilities, being able to reduce both selenate and selenite . The relationship between SecD function and selenium metabolism involves several potential connections:

  • Transport of selenoproteins:

    • SecD may be involved in the translocation of proteins essential for selenium metabolism

    • This includes components of the selenite reductase enzyme system

    • The respiratory selenite reductase (Srr) identified in related organisms requires proper secretion/localization

  • Stress response during selenium exposure:

    • Selenium oxyanions can cause stress, requiring increased protein secretion

    • SecD function may be upregulated during selenium metabolism

    • Adaptation to selenium-rich environments may involve specialized protein secretion patterns

  • Potential role in selenium detoxification:

    • SecD-dependent secretion might contribute to selenium detoxification mechanisms

    • Export of proteins involved in selenium conversion to less toxic forms

    • Membrane protein complexes for selenium efflux may depend on SecD for assembly

While D. indicum's selenium metabolism shares similarities with Bacillus selenitireducens strain MLS10, which possesses a selenite reductase (Srr) with specific subunits (SrrA, SrrB, SrrC, SrrD, SrrE, and SrrF) , the exact role of SecD in facilitating the proper localization of these enzymes requires further investigation.

How can researchers design experiments to elucidate the role of SecD in selenium-reducing bacteria?

To investigate the specific role of SecD in selenium-reducing bacteria like D. indicum, researchers can employ a strategic experimental approach:

  • Comparative genomics and transcriptomics:

    • Compare secD gene expression levels between selenium-exposed and unexposed conditions

    • Analyze co-expression patterns of secD with selenium metabolism genes

    • Identify potential regulatory elements in the secD promoter region responsive to selenium

  • SecD knockout/knockdown studies:

    • Generate SecD-deficient or SecD-depleted D. indicum strains

    • Assess impacts on selenium reduction capabilities

    • Measure expression and localization of selenium metabolism enzymes in these strains

  • Protein-protein interaction studies:

    • Use pull-down assays with tagged SecD to identify interaction partners

    • Verify interactions with components of selenium reduction pathways

    • Employ bacterial two-hybrid systems to map interaction domains

  • Subcellular localization experiments:

    • Track the localization of fluorescently tagged selenite reductase components in SecD-deficient strains

    • Compare with wild-type localization patterns

    • Determine if SecD is required for proper membrane insertion or periplasmic localization

  • Bioinformatic analysis of signal sequences:

    • Analyze signal sequences of known selenium metabolism proteins

    • Predict SecD dependence based on sequence features

    • Design reporter constructs to test these predictions experimentally

What quality control measures should be implemented when working with recombinant D. indicum SecD?

When working with recombinant D. indicum SecD, implementing rigorous quality control measures is essential:

  • Purity assessment:

    • SDS-PAGE analysis to confirm purity ≥85%

    • Western blotting with specific antibodies against SecD or affinity tags

    • Mass spectrometry to verify protein identity and detect potential modifications

  • Functional validation:

    • ATPase stimulation assays in reconstituted systems

    • Protein translocation activity measurements

    • Proton transport assays for the SecDF complex

  • Structural integrity verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to determine protein stability

    • Size-exclusion chromatography to detect aggregation

  • Storage and handling protocols:

    • Maintain in Tris-based buffer with 50% glycerol

    • Store at -20°C or -80°C for extended periods

    • Keep working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Batch-to-batch consistency:

    • Standardized expression and purification protocols

    • Reference standards for activity comparisons

    • Detailed documentation of production parameters

What are common challenges in recombinant SecD expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant membrane proteins like D. indicum SecD:

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Consider fusion partners that enhance expression (e.g., MBP, SUMO)

    • Evaluate multiple expression hosts (E. coli, yeast, baculovirus, mammalian cells)

  • Protein misfolding and aggregation:

    • Lower expression temperature to slow protein synthesis

    • Co-express with chaperones specific for membrane proteins

    • Optimize cell lysis and membrane extraction procedures

    • Screen various detergents for optimal solubilization

  • Proteolytic degradation:

    • Include protease inhibitors throughout purification

    • Use protease-deficient expression strains

    • Optimize buffer conditions to enhance stability

    • Consider fusion partners that enhance stability

  • Loss of function during purification:

    • Maintain native-like lipid environment when possible

    • Screen lipid additives that preserve function

    • Minimize exposure to harsh conditions

    • Validate function at each purification step

  • Crystallization difficulties:

    • Screen detergent and lipid combinations systematically

    • Consider lipidic cubic phase crystallization

    • Test engineered constructs with removed flexible regions

    • Explore alternative structural determination methods such as cryo-EM

What emerging technologies might enhance our understanding of SecD function in D. indicum?

Several cutting-edge technologies show promise for advancing our understanding of SecD function:

  • Cryo-electron microscopy:

    • Near-atomic resolution structures of membrane protein complexes

    • Visualization of different conformational states during the translocation cycle

    • Integration with other structural data for complete mechanistic models

  • Single-molecule techniques:

    • FRET-based approaches to track protein dynamics in real-time

    • Optical tweezers to measure forces during translocation

    • Super-resolution microscopy to visualize SecD distribution and dynamics in vivo

  • Synthetic biology approaches:

    • Minimal Sec systems reconstituted from defined components

    • Designer SecD variants with enhanced or altered functions

    • Integration of unnatural amino acids for site-specific probing

  • Computational methods:

    • Advanced molecular dynamics simulations of the complete SecDF-SecYEG complex

    • Machine learning to predict substrate preferences and translocation efficiency

    • Systems biology models of the entire protein secretion pathway

  • CRISPR-Cas9 genome editing:

    • Precise modification of secD in its native context

    • Creation of conditional mutants for in vivo functional studies

    • High-throughput screening of SecD variants

These technologies, combined with homologous recombination-based genetic engineering approaches like the λ Red system , will enable researchers to address complex questions about SecD function that were previously inaccessible.

How might research on D. indicum SecD contribute to broader understanding of bacterial adaptation to extreme environments?

Research on D. indicum SecD has significant implications for understanding bacterial adaptation to extreme environments:

  • Selenium-rich environments:

    • D. indicum thrives in selenium-contaminated settings through specialized protein secretion systems

    • SecD may play a crucial role in the export or membrane integration of detoxification proteins

    • Comparison with SecD from non-selenium-respiring bacteria may reveal adaptive features

  • Other extreme conditions:

    • Insights from D. indicum SecD may apply to protein secretion in other extremophiles

    • Structural adaptations that maintain function under stress could be identified

    • Comparative studies across extremophiles could reveal convergent evolutionary strategies

  • Environmental applications:

    • Understanding selenium metabolism proteins dependent on SecD could inform bioremediation strategies

    • Engineered bacteria with enhanced secretion capabilities might improve environmental cleanup

    • Knowledge of adaptation mechanisms could help predict bacterial responses to environmental changes

  • Evolutionary implications:

    • SecD conservation across diverse bacteria suggests fundamental importance

    • Species-specific adaptations reveal evolutionary pressure points

    • Horizontal gene transfer events involving secD might contribute to rapid adaptation

The study of D. indicum SecD thus serves as a model for understanding the molecular basis of specialized bacterial adaptations to challenging environmental niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.