Recombinant Desulfurispirillum indicum Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Biological Role of SecF in Protein Translocation

SecF is part of the SecDF complex, which functions alongside the SecYEG channel and ATPase SecA to mediate late-stage protein translocation in bacteria . Key roles include:

  • Enhancing translocation efficiency: SecDF stabilizes the proton motive force (PMF) required for post-translational protein export .

  • Cold sensitivity: Depletion of SecDF causes cold-sensitive growth defects and impaired protein secretion .

  • Interaction with SecYEG: Structural studies reveal that SecDF dynamically associates with the SecYEG translocon, promoting conformational changes essential for substrate release into the periplasm .

In D. indicum, SecF (encoded by the selin_2366 locus ) is hypothesized to support the secretion of proteins involved in anaerobic respiration pathways, such as selenate and arsenate reductases .

Domain Architecture

  • Transmembrane helices: SecF contains 6–12 transmembrane domains, depending on the organism .

  • Periplasmic P1 domain: Critical for substrate interaction and PMF utilization .

  • Conserved motifs: Asp365 in transmembrane helix 5 is essential for proton transport and conformational changes .

Conformational Dynamics

  • Resting state: Compact conformation near the lipid bilayer surface .

  • Active state: Extended periplasmic protrusions facilitate substrate release upon SecYEG binding .

Research Applications

  • Mechanistic studies: Used to investigate PMF-driven protein translocation in D. indicum and related bacteria .

  • Bioremediation: Potential role in exporting enzymes involved in selenium/arsenate detoxification .

  • Structural biology: Serves as a template for cryo-EM and atomic force microscopy (AFM) studies of SecDF conformational dynamics .

Comparative Analysis with Other SecDF Systems

FeatureD. indicum SecFE. coli SecDF
Genetic OrganizationSingle secF gene secD and secF as separate genes
EssentialityLikely non-essential (inferred) Critical for viability at low temperatures
Structural FormPartial recombinant constructs available Full-length crystal structures resolved

Challenges and Future Directions

  • Functional characterization: Limited data exist on D. indicum SecF’s role in native secretion pathways .

  • Structural studies: Full-length structural models are needed to elucidate species-specific adaptations.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery times, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for customers.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us, and we will prioritize developing that tag.
Synonyms
secF; Selin_2366; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Desulfurispirillum indicum (strain ATCC BAA-1389 / S5)
Target Names
secF
Target Protein Sequence
MRLRFYYIPFMRLRTYAVAVSAILVAIALISMGTRGLNFGIDFTGGALVQLEFQQPPVIE EIRSHLSAVGLGDSTIQHFGSDREILVRAPIISDESAAAMELISLIRETLSAQYGDQMDV LRIETVGPRVGGELREQGTYAILYALLAIVAYIWWRYELNFGVAAVIALVHDVVITLGIF SLAGVTFSLPVLAAILTVIGYSLNDTIVVFDRIRENLYIPEGKEKPSIISIINTSITETL SRTILTSGTTLIVVAVLYFFGGEVINGFAFTLLVGIIVGTYSSIFVASLLLVYWRPRYIE PHLKKLQEKPEEVV
Uniprot No.

Target Background

Function
SecF is an integral component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Desulfurispirillum indicum and why is it significant for researchers studying protein translocation?

Desulfurispirillum indicum strain S5 is a strictly anaerobic, Gram-negative, spiral-shaped bacterium isolated from river sediment in Chennai, India. It belongs to the deep-branching phylum Chrysiogenetes, which currently includes only four cultured species. The significance of D. indicum lies in its unique metabolic versatility, being capable of growth using selenate, selenite, arsenate, nitrate, or nitrite as terminal electron acceptors .

The bacterium's 2,928,377 bp genome encodes 2,619 proteins and 49 RNA genes, making it an excellent model organism for studying microbially-mediated transformations of arsenic and selenium compounds . This organism is particularly valuable for research because it's the only characterized member of Chrysiogenetes capable of dissimilatory reduction of both arsenate and selenate, in addition to nitrate and nitrite respiration. This metabolic versatility makes D. indicum an ideal system for identifying and elucidating pathways for selenate and arsenate oxyanion respiration and their regulation.

What is the primary function of the Protein translocase subunit SecF in bacterial systems?

The Protein translocase subunit SecF is an essential component of the bacterial Sec protein translocation pathway, which is responsible for transporting proteins across the cytoplasmic membrane. In bacterial systems, the Sec pathway consists of several proteins, including SecY, SecE, and SecG (which form the translocation channel), SecA (the ATPase that provides energy), and the accessory proteins SecD and SecF.

SecF specifically works in conjunction with SecD to enhance protein export by preventing the backward movement of pre-proteins during translocation. While not explicitly detailed in the search results for D. indicum specifically, research in model organisms has shown that SecF plays crucial roles in:

  • Maintaining the proton motive force necessary for protein translocation

  • Stabilizing the translocation intermediate

  • Assisting in the release of translocated proteins into the periplasm

In D. indicum, the SecF protein (locus tag Selin_2366) likely performs similar functions as part of the protein secretion machinery, particularly for proteins involved in the organism's unique selenium and arsenic metabolism pathways.

How does SecF contribute to the unique metabolic capabilities of D. indicum?

D. indicum possesses the distinctive ability to use multiple electron acceptors including selenate, selenite, arsenate, nitrate, and nitrite. The SecF protein likely plays an indirect but crucial role in these metabolic processes by facilitating the translocation of key enzymes and proteins involved in these respiratory pathways across the cytoplasmic membrane.

The search results indicate that D. indicum accumulates electron-dense selenium granules when grown in selenium-containing media . The formation and export of these selenium particles likely involve specialized proteins. In related bacteria, a protein called SefA has been identified in selenium nanosphere assembly . The search results mention that a SefA homologue (Selin_0231) has been identified in D. indicum strain S5, along with a methyltransferase called SefB (Selin_0233) .

The SecF translocase subunit may be involved in the translocation of these and other proteins necessary for the bacterium's selenium and arsenic metabolism. Proper localization of these proteins to their respective cellular compartments is essential for the unique metabolic capabilities that distinguish D. indicum from other bacteria.

What expression systems are recommended for producing recombinant D. indicum SecF protein?

Based on research with similar membrane proteins and information from the search results, the following expression systems would be recommended for recombinant D. indicum SecF production:

E. coli-based expression systems:

  • BL21(DE3) with pET vector systems (such as pET33b mentioned in relation to SefA protein expression)

  • C41(DE3) or C43(DE3) strains, which are specifically designed for expressing toxic membrane proteins

  • Tuner™ strains that allow controlled expression levels through adjustable IPTG concentrations

For optimal expression, consider these methodological approaches:

  • Temperature optimization: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction strategy: Mild induction with lower IPTG concentrations (0.1-0.5 mM)

  • Fusion tags: Addition of solubility-enhancing tags such as MBP, SUMO, or Thioredoxin

  • Membrane-mimicking conditions: Addition of mild detergents during cell lysis

From the search results, we can see that a related protein (SefA) from a selenate-respiring bacterium was successfully expressed in E. coli using the pET33b vector with IPTG induction . Similar strategies could be employed for SecF, though specific optimization would be required given its membrane-integrated nature.

What purification methods are most effective for isolating D. indicum SecF protein?

Purification of membrane proteins like SecF requires specialized approaches. Based on the search results and standard practices for membrane protein purification, the following methodological workflow is recommended:

Recommended purification workflow:

  • Membrane isolation:

    • Cell disruption via French press or sonication

    • Differential centrifugation to isolate membrane fractions

    • Washing steps to remove peripheral proteins

  • Solubilization:

    • Screening multiple detergents (DDM, LDAO, or Fos-choline series)

    • Optimization of detergent concentration and buffer conditions

    • Inclusion of lipids to stabilize the protein during extraction

  • Affinity chromatography:

    • If the recombinant protein contains a His-tag (as mentioned for SefA in the search results ), use Ni-NTA or TALON resins

    • Careful optimization of imidazole concentrations in wash and elution buffers

    • Consider on-column detergent exchange if necessary

  • Size exclusion chromatography:

    • Final purification step to isolate properly folded, monodisperse protein

    • Assessment of oligomeric state and protein stability

  • Quality control:

    • SDS-PAGE analysis for purity

    • Western blot for identity confirmation

    • Dynamic light scattering for homogeneity assessment

For storage, the purified protein should be maintained at -20°C or -80°C with 50% glycerol in a Tris-based buffer, as indicated for the commercially available recombinant protein .

How can researchers verify the functional activity of recombinant SecF protein?

Verifying the functional activity of recombinant SecF is essential before using it in experimental studies. The following methodological approaches are recommended:

In vitro functional assays:

  • Reconstitution in proteoliposomes:

    • Incorporate purified SecF (along with other Sec components) into liposomes

    • Measure protein translocation of model substrates across the membrane

    • Assess proton transport activity associated with SecDF function

  • ATPase stimulation assays:

    • Measure the ability of SecF to enhance the ATPase activity of SecA in the presence of translocation substrates

    • Compare activity with and without SecF to determine functional contribution

  • Protein-protein interaction studies:

    • Use cross-linking techniques to verify interactions with other Sec components

    • Apply microscale thermophoresis or surface plasmon resonance to measure binding affinities

    • Perform co-immunoprecipitation assays to confirm complex formation

  • Complementation assays:

    • Express recombinant D. indicum SecF in SecF-deficient E. coli strains

    • Assess restoration of growth and protein secretion phenotypes

    • Measure secretion efficiency of reporter proteins

Each assay provides different information about SecF functionality, and a combination of approaches is recommended for comprehensive validation of the recombinant protein.

What are the challenges in working with membrane proteins from anaerobic organisms like D. indicum?

Working with membrane proteins from anaerobic organisms presents several unique challenges that researchers should anticipate and address methodologically:

Key challenges and solutions:

  • Maintaining protein stability during aerobic purification:

    • Problem: Exposure to oxygen may alter protein conformation or oxidize critical residues

    • Solution: Perform purification steps under nitrogen atmosphere or add reducing agents like DTT or β-mercaptoethanol to buffers

  • Preserving native lipid environment:

    • Problem: Anaerobic organisms often have unique membrane compositions

    • Solution: Consider including lipid extracts from D. indicum or similar anaerobes during purification and storage

  • Low expression yields:

    • Problem: Heterologous expression of anaerobic membrane proteins often results in poor yields

    • Solution: Screen multiple expression hosts, including anaerobic expression systems when possible; optimize codon usage for expression host; use stronger promoters or fusion partners

  • Proper folding in heterologous hosts:

    • Problem: Correct insertion into membranes may be compromised in aerobic expression hosts

    • Solution: Express at lower temperatures; include chemical chaperones in growth media; consider expression in anaerobic hosts

  • Functional verification under anaerobic conditions:

    • Problem: Standard activity assays may not reflect natural anaerobic function

    • Solution: Develop specialized activity assays under anaerobic conditions that mimic the native environment

  • Limited structural information:

    • Problem: Few structural studies exist for membrane proteins from deep-branching phyla

    • Solution: Use computational modeling based on homologs; pursue structural studies with stabilizing modifications

By anticipating these challenges and implementing appropriate methodological strategies, researchers can successfully work with membrane proteins from anaerobic organisms like D. indicum.

How can D. indicum SecF be used to study protein translocation mechanisms in extremophiles?

The SecF protein from D. indicum represents a valuable system for investigating protein translocation in extremophiles and phylogenetically distinct bacteria. Here are methodological approaches to leverage this protein for such studies:

Comparative genomics approach:

  • Perform phylogenetic analysis of SecF sequences across diverse bacterial phyla, particularly focusing on extremophiles

  • Identify conserved and divergent domains that may correlate with environmental adaptations

  • Use this information to map functional regions of the protein that have evolved for specific environmental conditions

Chimeric protein studies:

  • Generate chimeric constructs containing domains from D. indicum SecF and well-studied model organisms

  • Express these chimeras in SecF-deficient strains

  • Assess which domains confer unique properties related to D. indicum's environmental adaptations

Substrate specificity analysis:

  • Identify putative secreted proteins in D. indicum, particularly those involved in selenate/arsenate metabolism

  • Test whether D. indicum SecF recognizes and facilitates translocation of these specialized substrates

  • Compare efficiency with standard substrates from model organisms

Structural studies under extreme conditions:

  • Analyze structural stability and conformational changes of D. indicum SecF under conditions mimicking its natural environment

  • Use techniques like hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Compare with SecF proteins from non-extremophilic bacteria to identify adaptations

This research direction would particularly benefit from combining biochemical approaches with in silico analysis and evolutionary studies to understand how protein translocation systems have adapted to extreme environments.

What is known about the relationship between SecF and metal/metalloid metabolism in D. indicum?

While the search results don't explicitly connect SecF to metal/metalloid metabolism in D. indicum, we can establish potential relationships based on the organism's unique metabolic capabilities and the role of SecF in protein translocation.

D. indicum is capable of growing with selenate, selenite, arsenate, nitrate, or nitrite as terminal electron acceptors . The proteins involved in these metabolic pathways must be properly localized, and many likely require the Sec pathway (including SecF) for translocation across the cytoplasmic membrane.

Research approaches to investigate this relationship:

  • Proteomics of the secretome:

    • Compare the secretome of wild-type D. indicum with SecF-depleted strains

    • Identify proteins involved in selenium/arsenic metabolism that show altered secretion patterns

    • Use quantitative proteomics to measure changes in protein abundance in different cellular compartments

  • Localization studies:

    • Generate reporter fusions with key enzymes involved in selenate/arsenate metabolism

    • Determine whether their proper localization depends on functional SecF

    • Use fluorescence microscopy or subcellular fractionation to track protein localization

  • Metabolic impact of SecF mutations:

    • Create conditional SecF mutants in D. indicum

    • Assess their ability to utilize different electron acceptors (selenate, arsenate, etc.)

    • Measure metal/metalloid reduction rates to quantify metabolic impacts

  • Protein-protein interaction network:

    • Use techniques like bacterial two-hybrid or co-immunoprecipitation to identify interactions between SecF and proteins involved in metal/metalloid metabolism

    • Map the interaction network to understand how these systems may be coordinated

The search results mention a protein called SefA that is involved in selenium nanosphere assembly in a selenate-respiring bacterium, with a homolog identified in D. indicum (Selin_0231) . This protein could be a candidate for SecF-dependent translocation, representing a potential direct link between SecF and selenium metabolism.

What methodological approaches can be used to study the role of SecF in selenium and arsenic transformations?

Investigating the specific role of SecF in selenium and arsenic transformations requires a combination of genetic, biochemical, and analytical techniques. The following methodological framework is recommended:

Genetic manipulation approaches:

  • Gene knockout or knockdown:

    • Create conditional SecF mutants in D. indicum using techniques like CRISPR interference

    • Assess growth phenotypes on media with different selenium or arsenic compounds

    • Measure transformation rates of these compounds using analytical techniques

  • Complementation studies:

    • Reintroduce wild-type or mutated SecF variants to assess restoration of function

    • Identify critical residues by site-directed mutagenesis that specifically affect selenium/arsenic metabolism

Biochemical approaches:

  • In vitro translocation assays:

    • Purify components of the Sec machinery including SecF

    • Assess translocation efficiency of specific substrates involved in selenium/arsenic metabolism

    • Compare translocation rates with standard model substrates

  • Protein localization studies:

    • Track localization of key enzymes involved in selenium/arsenic transformations in wild-type versus SecF-depleted cells

    • Use techniques like immunogold electron microscopy for precise localization

Analytical approaches:

  • Speciation analysis:

    • Use techniques like HPLC-ICP-MS to measure different selenium and arsenic species in wild-type versus SecF-mutant strains

    • Track transformation kinetics to identify specific steps affected by SecF deficiency

  • Electron microscopy:

    • Examine formation of selenium nanospheres (as mentioned in the search results ) in wild-type versus SecF-mutant cells

    • Quantify size, distribution, and intracellular versus extracellular localization of these particles

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and SecF-deficient strains growing on selenium or arsenic compounds

    • Identify compensatory pathways activated in response to SecF deficiency

The search results mention that D. indicum accumulates electron-dense granules when grown in the presence of selenium . This phenotype could serve as a visible marker for assessing the impact of SecF mutations on selenium metabolism.

How can structural studies of D. indicum SecF contribute to our understanding of prokaryotic protein translocation systems?

Structural studies of D. indicum SecF would provide valuable insights into protein translocation systems, particularly for phylogenetically distinct bacteria. The following methodological approaches would be most informative:

Structural determination methods:

  • X-ray crystallography:

    • Purify SecF in mild detergents or using lipidic cubic phase methods

    • Screen various conditions to obtain well-diffracting crystals

    • Solve structure at high resolution to identify unique features

  • Cryo-electron microscopy:

    • Reconstitute SecF with other Sec components to form the complete translocon

    • Perform single-particle cryo-EM to determine the structure of the complex

    • Capture different conformational states during the translocation cycle

  • Integrative structural biology:

    • Combine lower-resolution techniques (SAXS, SANS) with computational modeling

    • Use crosslinking mass spectrometry to identify interaction interfaces

    • Validate models with mutagenesis and functional assays

Key research questions to address:

  • Structural adaptations for extreme environments:

    • Identify unique structural features of D. indicum SecF compared to model organisms

    • Correlate these features with the organism's ability to thrive in its specific niche

  • Substrate specificity determinants:

    • Map regions involved in substrate recognition, particularly for specialized secreted proteins

    • Compare with SecF from organisms with different metabolic capabilities

  • Phylogenetic insights:

    • Determine whether D. indicum SecF structure represents a more ancestral form of the protein

    • Use structural information to refine evolutionary models of protein translocation systems

  • Energy coupling mechanism:

    • Identify structural features involved in harnessing the proton motive force

    • Characterize conformational changes associated with the translocation cycle

D. indicum belongs to the deep-branching phylum Chrysiogenetes , making its SecF protein particularly valuable for evolutionary studies of essential cellular machinery across the tree of life.

What are the recommended controls for experiments involving recombinant D. indicum SecF?

When designing experiments with recombinant D. indicum SecF, appropriate controls are essential for valid interpretation of results. The following controls should be included:

For expression studies:

  • Negative control: Expression host containing empty vector without the secF gene

  • Positive control: Well-characterized protein expressed under identical conditions

  • Expression timing controls: Samples collected at different time points post-induction (as demonstrated for SefA in the search results)

  • Induction controls: Varying concentrations of inducer to optimize expression

For purification assessment:

  • Mock purification: Process lysate from cells not expressing the target protein

  • Quality controls: Analysis of protein purity, homogeneity, and stability using multiple methods

  • Tag-only control: Expression and purification of the affinity tag alone

For functional assays:

  • Inactive mutant: SecF with mutations in critical residues to serve as negative control

  • Homologous protein: SecF from well-studied organism (e.g., E. coli) as reference point

  • Buffer controls: Ensure observed effects are protein-specific rather than buffer-dependent

  • Substrate controls: Include non-specific substrates to assess selectivity

For cellular studies:

  • Complementation controls: Wild-type cells and cells with complete secF deletion

  • Localization controls: Proteins known to use SecF-dependent and SecF-independent pathways

These controls should be tailored to specific experimental designs while maintaining the core principle of isolating the effect of D. indicum SecF from other variables.

What are the key considerations for designing experiments to study SecF interactions with other proteins in the Sec pathway?

Studying protein-protein interactions involving membrane proteins like SecF requires specialized experimental approaches. When investigating SecF interactions with other components of the Sec pathway, consider the following methodological aspects:

Experimental design considerations:

  • Membrane environment preservation:

    • Use mild detergents that maintain native-like membrane environments

    • Consider nanodiscs or liposomes for reconstitution studies

    • Test multiple detergent conditions to ensure interactions aren't disrupted

  • Tag position and interference:

    • Carefully consider tag placement to avoid disrupting interaction interfaces

    • Compare N-terminal and C-terminal tags to identify optimal constructs

    • Include tag-removal options when possible

  • Interaction detection methods selection:

    • For transient interactions: Cross-linking followed by mass spectrometry

    • For stable complexes: Co-immunoprecipitation or pull-down assays

    • For quantitative measurements: Surface plasmon resonance or microscale thermophoresis

    • For in vivo studies: Bacterial two-hybrid or FRET-based approaches

  • Control for non-specific interactions:

    • Include abundant membrane proteins as negative controls

    • Test interaction specificity through competition assays

    • Validate interactions through multiple independent methods

Specific interaction partners to investigate:

  • Core Sec components: SecY, SecE, SecG forming the channel

  • Motor protein: SecA providing energy for translocation

  • Accessory proteins: SecD functioning with SecF

  • Substrate proteins: Particularly those involved in selenate/arsenate metabolism

The experimental design should account for the membrane-integrated nature of these interactions and utilize techniques that can detect both stable and transient protein-protein interactions in a near-native environment.

What challenges should researchers anticipate when working with recombinant D. indicum proteins in heterologous expression systems?

Working with recombinant proteins from phylogenetically distant organisms like D. indicum presents several challenges that researchers should anticipate and address methodologically:

Expression challenges and solutions:

  • Codon usage bias:

    • Problem: D. indicum codon usage may differ significantly from expression hosts

    • Solution: Synthesize codon-optimized genes for the expression host; use specialized strains with rare tRNAs

  • Toxic effects on host cells:

    • Problem: Expression of foreign membrane proteins may disrupt host cell membrane integrity

    • Solution: Use tightly regulated expression systems; lower induction levels; use specialized strains like C41/C43 designed for toxic proteins

  • Post-translational modifications:

    • Problem: Modifications present in D. indicum may be absent in heterologous hosts

    • Solution: Consider eukaryotic expression systems if specific modifications are essential; engineer required modifications

  • Protein folding and stability:

    • Problem: Proteins may misfold in foreign cellular environments

    • Solution: Express at lower temperatures; co-express chaperones; include osmolytes in growth media

Experimental evidence from search results:

  • SefA formed larger selenium nanospheres in E. coli (approximately 300 nm) compared to its native host (approximately 150 nm)

  • The selenium nanospheres were retained within E. coli cells, whereas in the native host they were secreted

This example illustrates the potential for altered protein function in heterologous hosts and underscores the importance of carefully validating protein function and behavior after heterologous expression.

How can researchers adapt methodologies from model organisms to study D. indicum SecF function?

Adapting established methodologies from model organisms to study proteins from non-model organisms like D. indicum requires careful consideration and modification. Here's a methodological framework for transferring techniques:

Adaptation strategies by experimental category:

  • Genetic manipulation techniques:

    • Start with broad-host-range plasmids that function across diverse bacteria

    • Optimize transformation protocols for D. indicum's cell wall/membrane composition

    • Adapt CRISPR-Cas systems with species-specific promoters and guide RNA design

    • Consider conjugation-based approaches if direct transformation is challenging

  • Protein expression and purification:

    • Test expression in multiple hosts (E. coli, Pseudomonas, etc.) to identify optimal systems

    • Modify buffer compositions to match D. indicum's physiological environment

    • Adjust detergent selection based on D. indicum's membrane composition

    • Incorporate stabilizing additives specific to the protein's requirements

  • Functional assays:

    • Modify assay conditions to reflect D. indicum's natural environment

    • Develop hybrid assay systems combining components from model and non-model organisms

    • Establish appropriate positive controls using homologous proteins from model organisms

    • Validate assay sensitivity and specificity for D. indicum proteins

  • Structural biology approaches:

    • Increase protein stability through targeted mutations based on homology modeling

    • Test multiple construct designs with varying terminal truncations

    • Explore fusion partners that have proven successful with homologous proteins

    • Consider nanobody or antibody fragments to stabilize specific conformations

Method adaptation examples:

TechniqueStandard ProtocolAdaptation for D. indicum SecF
Genetic knockoutCRISPR-Cas9 with standard promotersModified guide RNA design; D. indicum-specific promoters
Protein purificationStandard detergents (DDM, LDAO)Screen detergent panel; include specific lipids from D. indicum
Complementation assayExpression in E. coli ΔsecFCodon optimization; lower expression temperature
Interaction studiesBacterial two-hybrid in E. coliModified bait/prey vectors; validation with known partners
Activity assaysStandard buffer conditionsAdjust pH, salt, and redox conditions to match natural environment

When adapting methodologies, incremental validation at each step is essential to ensure that the modified techniques produce reliable results with D. indicum proteins.

What are the most promising research directions for understanding D. indicum SecF function?

Based on the current knowledge and technological capabilities, several research directions show particular promise for advancing our understanding of D. indicum SecF function:

  • Comparative analysis across Chrysiogenetes:

    • Systematically compare SecF structure and function across the limited members of this deep-branching phylum

    • Identify unique features that distinguish these SecF proteins from those in well-studied phyla

    • Correlate SecF variations with metabolic capabilities across species

  • SecF's role in metalloid metabolism:

    • Investigate whether SecF is specifically adapted for translocation of proteins involved in selenium and arsenic metabolism

    • Determine if SecF variations contribute to D. indicum's unique ability to use both arsenate and selenate as electron acceptors

    • Explore potential direct interactions between SecF and specialized secretion systems for selenium nanospheres

  • Structural biology of ancestral translocation systems:

    • Pursue structural studies of the complete Sec translocon from D. indicum

    • Compare with structures from model organisms to identify evolutionary conserved and divergent features

    • Use this information to reconstruct the ancestral state of protein translocation machinery

  • Systems biology of protein secretion networks:

    • Map the complete protein secretion network in D. indicum

    • Identify SecF-dependent and SecF-independent pathways

    • Determine how these networks are regulated in response to different electron acceptors

These research directions would not only advance our understanding of D. indicum specifically but would also contribute to broader knowledge about protein translocation systems across the tree of life and their roles in specialized metabolic processes.

What emerging technologies might enhance research on D. indicum SecF in the near future?

Several emerging technologies show promise for advancing research on D. indicum SecF and similar proteins from non-model organisms:

  • Advanced cryo-EM techniques:

    • Developments in cryo-electron tomography could allow visualization of SecF in its native membrane environment

    • Improved single-particle analysis for membrane proteins will facilitate structure determination at higher resolution

    • Time-resolved cryo-EM may capture dynamic conformational changes during the translocation cycle

  • Synthetic biology approaches:

    • Designer expression systems tailored for difficult membrane proteins

    • Cell-free protein synthesis systems optimized for membrane protein production

    • Minimal cell systems that can be customized for specific protein translocation studies

  • Advanced genetic tools for non-model organisms:

    • CRISPR-Cas systems optimized for diverse bacterial phyla

    • Improved transformation protocols for recalcitrant bacteria

    • Site-specific recombination systems for precise genetic manipulation

  • Artificial intelligence applications:

    • Machine learning for predicting protein-protein interactions

    • Improved structural prediction tools specifically for membrane proteins

    • Systems biology models to predict effects of SecF mutations on cellular physiology

  • Single-molecule techniques:

    • High-sensitivity FRET to monitor conformational changes during translocation

    • Optical tweezers to measure forces during protein translocation

    • Single-molecule tracking in live cells to monitor SecF dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.