Recombinant Diadromus pulchellus idnoreovirus 1 Uncharacterized protein S9 (S9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
S9; Uncharacterized protein S9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Diadromus pulchellus idnoreovirus 1 (DpIRV-1)
Target Names
S9
Target Protein Sequence
MTSTMKLFTDHAEISVRERPPQRNNNNQEQDNSNRPAPRRLFGLNEKYNFDQPETTFDKL LHQICLGNYEQVDDKIINDSITLAALRKYSCEYKDLKPEKAPKLKNECMKQFAQPGQVVE IIGIDLPLDSSIDQDDLYDLKDDNDVIPVLRVYQSAQDARTKTTENKKDYILDTRVIPDN FAASLFLKSVLRAILLQIFSSLQNQLVKTDVATNPEFMRMSNAFASTRRGPFYNIASLVP ALSYPDSRSVPLIVGFILTQENLSLLSLYSMIVTTKVSSTIMALYENNSSEEECEDSISA ASCTNQSNVNNSDNIRMTITLPCGLTIAFFVYYRYTLFQRRVKCSTSILLSS
Uniprot No.

Target Background

Subcellular Location
Host cell membrane; Single-pass membrane protein.

Q&A

What is Diadromus pulchellus idnoreovirus 1 and its relationship to the S9 protein?

Diadromus pulchellus idnoreovirus 1 (DpIRV-1) is a virus that infects Diadromus pulchellus, a parasitoid wasp in the family Ichneumonidae. D. pulchellus is primarily known as an effective parasitoid of the leek moth (Acrolepiopsis assectella), with parasitism rates of up to 95% . The S9 protein is one of the viral proteins produced by DpIRV-1, currently classified as "uncharacterized" because its specific function in viral replication and pathogenesis has not been fully elucidated.

The S9 protein is identified in UniProt under the accession number Q86283, indicating it has been sequenced and recorded in protein databases, but detailed functional studies are still emerging .

What are the recommended storage and handling conditions for the recombinant protein?

For optimal stability and activity preservation of Recombinant Diadromus pulchellus idnoreovirus 1 Uncharacterized protein S9, the following storage and handling conditions are recommended:

  • Primary storage: Store at -20°C; for extended preservation, store at -80°C

  • Working storage: Maintain working aliquots at 4°C for up to one week

  • Buffer composition: Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended and should be avoided to maintain protein integrity

  • Quantity available: Typically supplied as 50 μg, with other quantities available upon request

How does the host organism (Diadromus pulchellus) ecology inform research on this protein?

Understanding the ecology of Diadromus pulchellus provides important context for research on DpIRV-1 and its proteins. D. pulchellus is a non-native parasitoid wasp established in the Northeastern United States and Canada, with documented presence since at least 1993 . It is adapted to temperate, cold-tolerant climates.

The wasp primarily parasitizes leek moth (Acrolepiopsis assectella) pupae, with approximately 95% specificity, though it can occasionally parasitize diamondback moths (P. xylostella) . This high specificity suggests potential co-evolutionary adaptations between the parasitoid, its hosts, and its viruses, which may be reflected in the specialized functions of viral proteins like S9.

What experimental approaches are optimal for studying the function of this uncharacterized protein?

To elucidate the function of the uncharacterized S9 protein, researchers should consider a multi-faceted experimental approach:

  • Structural analysis: Employ X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure.

  • Expression system optimization: Test expression in different systems (bacterial, insect, mammalian) to obtain properly folded, functional protein.

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with host cell proteins

    • Pull-down assays with viral and host proteins

  • Localization studies: Use fluorescently tagged S9 protein to determine subcellular localization during viral infection.

  • Functional genomics: Employ CRISPR-Cas9 to introduce mutations in the S9 gene and observe effects on viral replication.

  • Comparative analysis: Compare with other idnoreovirus proteins and related viral protein families to infer potential functions.

These approaches should be conducted in both in vitro systems and, where possible, in the context of the natural host-parasite system to capture authentic biological relevance.

What bioinformatic tools are most valuable for analyzing this protein?

Researchers should employ the following bioinformatic tools and approaches when working with the S9 protein:

  • Structural prediction tools:

    • AlphaFold2 for protein structure prediction

    • SWISS-MODEL for homology modeling

    • PSIPRED for secondary structure prediction

  • Functional prediction tools:

    • InterProScan for domain identification

    • MOTIF Search for motif identification

    • ConSurf for evolutionary conservation analysis

  • Sequence analysis tools:

    • BLAST for identifying homologous proteins

    • MUSCLE or Clustal Omega for multiple sequence alignment

    • MEGA for phylogenetic analysis

  • Protein-protein interaction prediction:

    • STRING database

    • ZDOCK for protein docking simulation

    • PredictProtein for functional site prediction

The integration of these computational approaches with experimental data will provide a more comprehensive understanding of this uncharacterized protein.

How might researchers address the challenges of working with viral proteins from non-model organisms?

Working with viral proteins from non-model organisms like Diadromus pulchellus presents several unique challenges that researchers must strategically address:

  • Limited reference data: Utilize cross-species comparative approaches and leverage well-characterized viral protein families to make informed predictions.

  • Expression system selection: Consider using insect cell lines that more closely resemble the natural host environment, such as Sf9 or High Five cells.

  • Antibody development: Generate specific antibodies against the S9 protein, which may require:

    • Multiple antigenic peptide selection

    • Careful validation across related species

    • Developing both polyclonal and monoclonal antibodies

  • Establishing model systems: Develop laboratory models that can recapitulate aspects of the natural host-virus interaction:

    • Cell culture systems from related insect species

    • Consider surrogate hosts if D. pulchellus is difficult to maintain

  • Collaborative approaches: Form interdisciplinary teams combining expertise in virology, entomology, structural biology, and computational biology.

What is the potential significance of S9 protein in understanding virus-host interactions?

The study of S9 protein may contribute significantly to understanding specialized virus-host interactions in several ways:

  • Host range determination: The S9 protein may play a role in determining the virus's specificity for D. pulchellus.

  • Immune evasion mechanisms: Like many viral proteins, S9 might function in counteracting host immune responses, providing insights into insect antiviral immunity.

  • Viral replication cycle: Understanding S9's role in the viral replication cycle could reveal novel mechanisms specific to idnoreoviruses.

  • Evolutionary adaptation: Comparative analysis with related viral proteins may reveal how this virus has adapted to its specific host.

  • Potential applications: Knowledge of virus-host interactions in this system could inform the development of biological control strategies for agricultural pests.

What are the recommended protocols for expression and purification of this recombinant protein?

For optimal expression and purification of the S9 recombinant protein, researchers should consider the following methodology:

  • Expression system selection:

    Expression SystemAdvantagesDisadvantagesRecommended Use Case
    E. coliHigh yield, low costPotential misfoldingInitial characterization
    Baculovirus/insect cellsBetter folding, PTMsHigher cost, complexFunctional studies
    Mammalian cellsBest for complex PTMsHighest cost, lowest yieldInteraction studies
  • Purification strategy:

    • IMAC (Immobilized Metal Affinity Chromatography) using histidine tag

    • Size exclusion chromatography for further purification

    • Consider ion exchange chromatography as a polishing step

  • Tag selection considerations:

    • The optimal tag type should be determined during the production process

    • Consider the impact of tags on protein folding and function

    • Include a cleavable tag design for studies requiring native protein

  • Quality control assessments:

    • SDS-PAGE for purity assessment

    • Western blot for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Circular dichroism for secondary structure confirmation

How can researchers design effective experiments to elucidate the function of this uncharacterized protein?

A systematic experimental approach is required to characterize the function of S9 protein:

  • Initial characterization:

    • Subcellular localization studies using fluorescently tagged protein

    • Temporal expression analysis during viral infection cycle

    • Identification of binding partners through co-immunoprecipitation or yeast two-hybrid screening

  • Loss-of-function studies:

    • RNA interference to knock down S9 expression

    • CRISPR-Cas9 gene editing to create S9 mutants

    • Assessment of viral replication efficiency in the absence of functional S9

  • Gain-of-function studies:

    • Overexpression of S9 in host cells

    • Introduction of S9 into heterologous systems

    • Analysis of cellular pathways affected by S9 expression

  • Structure-function relationships:

    • Creation of domain deletion mutants

    • Site-directed mutagenesis of conserved residues

    • Correlation of structural features with functional outcomes

  • Comparative analysis:

    • Functional comparison with related viral proteins

    • Evolutionary analysis to identify conserved functional domains

What considerations are important for analyzing protein-protein interactions involving S9?

When studying protein-protein interactions involving the S9 protein, researchers should consider:

  • Selection of appropriate detection methods:

    MethodAdvantagesLimitationsBest Application
    Co-immunoprecipitationDetects native interactionsRequires good antibodiesVerification of in vivo interactions
    Yeast two-hybridHigh-throughput screeningProne to false positivesInitial interactome mapping
    Bimolecular Fluorescence ComplementationVisualizes interactions in cellsMay force interactionsCellular context studies
    Surface Plasmon ResonanceQuantitative binding kineticsRequires purified proteinsDetailed binding analysis
  • Controls and validation:

    • Include appropriate negative controls (unrelated proteins)

    • Use multiple complementary methods for validation

    • Confirm biological relevance through functional assays

  • Context considerations:

    • Evaluate interactions in relevant cell types

    • Consider temporal aspects of interactions

    • Assess dependency on post-translational modifications

  • Network analysis:

    • Build interaction networks to understand broader context

    • Identify hub proteins and key pathways

    • Integrate with transcriptomic and proteomic data

What analytical techniques are most appropriate for studying the structural properties of S9?

To characterize the structural properties of the S9 protein, researchers should consider these analytical techniques:

  • High-resolution structural analysis:

    • X-ray crystallography for atomic-level resolution

    • Cryo-electron microscopy for native-state visualization

    • NMR spectroscopy for dynamic structural information

  • Spectroscopic methods:

    • Circular dichroism for secondary structure composition

    • Fluorescence spectroscopy for tertiary structure assessment

    • FTIR for complementary secondary structure information

  • Hydrodynamic techniques:

    • Analytical ultracentrifugation for oligomeric state determination

    • Size-exclusion chromatography with multi-angle light scattering

    • Dynamic light scattering for homogeneity assessment

  • Computational approaches:

    • Molecular dynamics simulations to predict protein behavior

    • Homology modeling based on related viral proteins

    • Ab initio structure prediction for novel domains

  • Stability and folding studies:

    • Differential scanning calorimetry for thermal stability

    • Chemical denaturation studies

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

How might research on S9 protein contribute to understanding viral evolution?

Studying the S9 protein can provide valuable insights into viral evolution through:

  • Comparative genomics approach:

    • Analysis of S9 homologs across related viruses

    • Identification of conserved domains suggesting essential functions

    • Mapping of variable regions that may contribute to host adaptation

  • Molecular evolution studies:

    • Analysis of selection pressures on different regions of the S9 gene

    • Identification of signatures of host-specific adaptation

    • Reconstruction of evolutionary history through phylogenetic analysis

  • Host-pathogen co-evolution:

    • Investigation of S9 interactions with host factors

    • Comparison of S9 adaptations across different host species

    • Correlation of S9 sequence variations with host range differences

This research could contribute to understanding how specialized viruses like DpIRV-1 evolve in concert with their host organisms and how viral proteins acquire new functions during evolutionary processes.

What are the potential applications of this research in biological control strategies?

Understanding the S9 protein and the broader biology of DpIRV-1 could inform biological control strategies:

  • Enhancement of parasitoid effectiveness:

    • Knowledge of virus-host interactions could improve rearing and deployment of D. pulchellus for leek moth control

    • Understanding viral effects on parasitoid fitness and behavior

  • Development of molecular tools:

    • Potential use of viral proteins in targeted pest management

    • Engineering of viral components for improved specificity or efficacy

  • Risk assessment:

    • Evaluation of potential host range expansion of the virus

    • Assessment of ecological impacts of parasitoid-virus systems

This application aligns with existing biological control applications of D. pulchellus, which is already established as an effective parasitoid of leek moth in the Northeastern United States and Canada, with parasitism rates of up to 95% .

How should researchers integrate this work with broader virus-host interaction studies?

To maximize the impact of research on the S9 protein, integration with broader virus-host interaction studies is essential:

  • Comparative systems approach:

    • Compare findings with other insect-virus systems

    • Identify common mechanisms and unique adaptations

    • Place findings in evolutionary context

  • Multi-omics integration:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Map interactions within cellular networks

    • Develop systems biology models of virus-host interactions

  • Ecological context:

    • Consider the tripartite interaction between virus, parasitoid, and host

    • Evaluate environmental factors affecting these interactions

    • Study population-level impacts and dynamics

  • Collaborative frameworks:

    • Establish research consortia focused on insect viruses

    • Develop shared resources and standardized protocols

    • Create open-access databases for comparative analyses

What are common challenges in working with recombinant viral proteins and their solutions?

Researchers commonly encounter several technical challenges when working with recombinant viral proteins like S9:

  • Expression challenges:

    ChallengePotential Solution
    Poor expression levelsOptimize codon usage for expression system
    Protein insolubilityUse solubility tags or optimize buffer conditions
    Protein misfoldingExpress at lower temperatures or use folding chaperones
    Toxicity to expression hostUse inducible expression systems or cell-free systems
  • Purification difficulties:

    • For aggregation issues, screen different detergents or solubilizing agents

    • For co-purifying contaminants, implement additional chromatography steps

    • For degradation during purification, include protease inhibitors

  • Storage stability problems:

    • Follow recommended storage in Tris-based buffer with 50% glycerol

    • Aliquot protein to avoid repeated freeze-thaw cycles

    • Consider addition of stabilizing agents like trehalose or BSA

  • Activity measurement challenges:

    • Develop function-specific assays based on bioinformatic predictions

    • Use surrogate systems if natural host systems are unavailable

    • Include appropriate positive and negative controls

How can researchers address reproducibility challenges in this field?

To ensure research reproducibility when working with the S9 protein:

  • Standardized protocols:

    • Develop and share detailed protocols for expression and purification

    • Specify exact buffer compositions and storage conditions

    • Document all experimental parameters comprehensively

  • Quality control measures:

    • Implement consistent protein quality assessment metrics

    • Verify protein identity through mass spectrometry

    • Assess batch-to-batch variation with standardized assays

  • Reporting standards:

    • Adhere to minimal information standards for protein characterization

    • Include detailed methods sections in publications

    • Share raw data through appropriate repositories

  • Collaborative validation:

    • Establish multi-laboratory validation of key findings

    • Develop reference standards for protein activity

    • Create community resources for protocol sharing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.