Recombinant Dicentrarchus labrax Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Function and Biochemical Properties

Recombinant D. labrax Rhodopsin functions as a photoreceptor protein critical for scotopic (low-light) vision. Like other rhodopsins, it operates through a well-characterized mechanism involving a vitamin A-derived chromophore .

Functional Mechanism

The protein functions through a light-dependent mechanism where:

  1. The protein binds to a chromophore (typically 11-cis retinal in marine species)

  2. Light exposure induces isomerization of 11-cis retinal to all-trans retinal

  3. This structural change triggers conformational shifts in the protein

  4. The activated rhodopsin interacts with G-proteins (transducin in visual systems)

  5. This interaction initiates a signaling cascade leading to visual signal transduction

  6. Receptor phosphorylation mediates displacement of bound G-protein alpha subunit by arrestin, terminating the signal

Unlike most freshwater fish that utilize 3-dehydroretinal as a chromophore, D. labrax, being a saltwater species, primarily uses retinal as its chromophore .

Biochemical Properties

The recombinant protein exhibits several key biochemical properties:

  • Optimum storage conditions: -20°C to -80°C

  • Buffer compatibility: Tris-based buffer with 50% glycerol

  • Stability considerations: Repeated freezing and thawing not recommended, with working aliquots stable at 4°C for up to one week

Production Systems and Recombinant Expression

Several expression systems have been developed for the production of recombinant rhodopsins, each with distinct advantages and challenges.

Expression Systems

Table 1: Comparison of Expression Systems for Recombinant Rhodopsins

Expression SystemAdvantagesDisadvantagesApplicationYield
Escherichia coliHigh yield, rapid production, cost-effectivePotential folding issues with membrane proteinsStructural studies, high-throughput screeningHigher than mammalian systems
Mammalian cells (CHO)Native-like post-translational modifications, proper foldingLower yield, higher costIn vivo studies, functional assaysLower than bacterial systems
Insect cells (Sf9)Moderate yield, eukaryotic processingGlycosylation patterns differ from vertebratesAntibody productionHigher than CHO but with different properties

Research indicates that while both insect and mammalian expression systems can successfully produce bioactive recombinant proteins, the choice of system impacts properties like glycosylation, which affects in vivo stability and biopotency .

Production Considerations

The successful production of recombinant D. labrax rhodopsin requires specific considerations:

  1. The inclusion of appropriate tags (often His-tag) for purification

  2. Optimization of buffer conditions for protein stability

  3. Addition of glycerol (typically 50%) to maintain protein integrity during storage

  4. Careful purification protocols to maintain functional conformation

Unlike many eukaryotic rhodopsins that have proven challenging to express in bacterial systems, certain rhodopsins can be functionally expressed in E. coli, which enables rapid production of large amounts of recombinant proteins .

Evolutionary Significance and Comparative Analysis

The study of recombinant D. labrax rhodopsin provides valuable insights into the evolution of visual systems in vertebrates, particularly in teleost fishes.

Evolutionary Context

Phylogenetic analysis of vertebrate rhodopsins reveals that these proteins have evolved under specific structural constraints. The rhodopsin gene (rho) was found to be retained in 56 of 59 ray-finned fish genomes analyzed in comprehensive studies . The evolutionary pattern of rhodopsin genes in teleost fishes shows complex patterns of gene duplication and loss, with D. labrax exhibiting specific adaptations in its rhodopsin sequence .

Research has identified that accessible residues in TM regions of rhodopsins exhibit a high rate of evolution, with the distribution of amino acid substitutions biased toward the surface of the protein that interfaces with lipids . This pattern suggests functional constraints on the core of the protein while allowing greater variability at the periphery.

Tuning Site Variations

Of particular interest are the tuning sites in the rhodopsin sequence that influence the maximum spectral absorbance (λmax). In D. labrax, a S164A substitution has been identified in the LWS (long-wave sensitive) opsin, resulting in a blue shift of the absorption spectrum . This adaptation likely reflects the specific light environment of the European seabass habitat.

Table 2: Key Tuning Site Substitutions in Dicentrarchus labrax Opsins

Tuning SiteAncestral AAD. labrax AAEffect on λmaxFunctional Significance
164S (Serine)A (Alanine)Blue shiftAdaptation to marine light environment
261Y (Tyrosine)Y (Tyrosine)No changeConservation of core function
292A (Alanine)A (Alanine)No changeConservation of core function

Applications in Research and Biotechnology

Recombinant D. labrax rhodopsin has several important applications in both basic research and biotechnological development.

Basic Research Applications

The recombinant protein serves as a valuable tool for:

  1. Structural studies of photoreceptor proteins

  2. Investigation of G-protein coupling mechanisms

  3. Comparative analyses of visual adaptations in marine vertebrates

  4. Studies of specific amino acid residues in determining spectral properties

Research using recombinant rhodopsins has enabled the measurement of protein activation properties through specialized assays. For example, one approach involves measuring the activation of G-protein alpha-subunits by recombinant rhodopsin in microsomal preparations .

Biotechnological Applications

Beyond basic research, recombinant rhodopsins have found applications in:

  1. Development of ELISA-based detection systems

  2. Engineering of light-sensitive biosensors

  3. Creation of rhodopsin-based photo-electrosynthetic systems

  4. Optogenetic tools for neuroscience research

Recent engineering efforts have demonstrated that rhodopsin can be integrated with electron donors to form closed redox loops, enabling light-dependent electron transfer chains. Such systems have applications in the development of organisms that can use solar energy to convert CO2 to biomass, chemicals, and fuels .

Analytical Methods and Characterization

Various analytical methods have been developed for the characterization of recombinant rhodopsin proteins.

Spectroscopic Characterization

Spectroscopic techniques are crucial for determining the functional properties of rhodopsins:

  1. Absorption spectroscopy to determine the λmax values

  2. Circular dichroism to assess secondary structure

  3. Fourier-transform infrared spectroscopy to evaluate structural changes upon activation

  4. Time-resolved spectroscopy to monitor photocycle kinetics

These techniques allow researchers to analyze the light-induced conformational changes that are central to rhodopsin function.

Future Research Directions

Research on recombinant D. labrax rhodopsin and related proteins continues to evolve, with several promising directions for future investigation.

Emerging Applications

Future research may focus on:

  1. Development of rhodopsin-based biosensors with enhanced sensitivity

  2. Creation of light-responsive materials for biomedical applications

  3. Engineering of rhodopsin variants with modified spectral properties

  4. Application in optogenetic tools for neuroscience

The successful expression of eukaryotic rhodopsins in bacterial systems opens possibilities for high-throughput screening and engineering of these proteins for various applications .

Comparative Studies

Further comparative studies between D. labrax rhodopsin and those of other species will enhance understanding of:

  1. Species-specific adaptations in visual systems

  2. The impact of habitat on rhodopsin evolution

  3. Structure-function relationships in G-protein coupled receptors

  4. Mechanisms of photoreceptor signal transduction

The ongoing characterization of rhodopsin variants across species continues to provide insights into the evolution and function of these essential visual proteins.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize the development of your specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Dicentrarchus labrax (European seabass) (Morone labrax)
Target Names
rho
Target Protein Sequence
MNGTEGPFFYVPMVNTTGIVRSPYDYPQYYLVSPAAYAALGAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNMEGFFATLG GEIGLWSLVVLAVERWLVVCKPISNFRFGENHAIMGLAFTWVMACSCAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVIYMFACHFIIPMCVVFFCYGRLLCAVKEAAAAQQES ETTQRAEKEVTRMVVIMGIAFLICWCPYASVAWYIFTHQGSEFGPVFMTLPAFFAKTSSV YNPLIYILMNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision at low light intensity. While most salt water fish species utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Dicentrarchus labrax Rhodopsin and what is its role in the visual system?

Dicentrarchus labrax rhodopsin (rho) is a photopigment molecule expressed in the retina of European seabass, a teleost fish species. As in other vertebrates, rhodopsin functions as the primary photoreceptor protein in rod cells responsible for dim-light vision. The protein belongs to the G-protein coupled receptor family and contains a covalently bound retinal chromophore that undergoes conformational changes upon light absorption, initiating the visual phototransduction cascade .

The full-length protein consists of 353 amino acids with several conserved domains typical of vertebrate rhodopsins, including seven transmembrane domains and the retinal-binding pocket . In sea bass, rhodopsin plays a critical role in adaptation to different light conditions in marine environments, with its expression and function being notably influenced by environmental factors such as temperature .

How does temperature affect rhodopsin expression and function in Dicentrarchus labrax?

Temperature significantly influences rhodopsin expression and potentially its function in European seabass, reflecting the ectothermic nature of teleost fish whose physiology is heavily dependent on environmental temperature. Research has demonstrated a clear temperature-dependent pattern in rhodopsin mRNA abundance:

  • At 28°C: Increased rhodopsin mRNA abundance

  • At 23°C: Moderate rhodopsin mRNA abundance

  • At 18°C: Decreased rhodopsin mRNA abundance

This temperature-dependent expression pattern suggests adaptation mechanisms in visual perception according to environmental temperature changes. The temperature effects appear to be specific to the protein level rather than affecting the entire melatonin synthesis pathway, as research shows no significant effect of temperature on mRNA levels of melatonin synthesis enzymes .

Additionally, temperature induces changes in the fatty acid composition of the retina, particularly in the distribution between neutral and polar lipids, which may indirectly affect rhodopsin function by altering membrane fluidity and protein-lipid interactions critical for photoreception .

What are the optimal conditions for expressing and purifying recombinant Dicentrarchus labrax Rhodopsin?

Expression System Selection:
For functional studies of recombinant D. labrax rhodopsin, mammalian expression systems (particularly HEK293 or COS cells) are generally preferred over bacterial systems to ensure proper folding and post-translational modifications. For structural studies requiring large protein quantities, insect cell systems (Sf9 or High Five) using baculovirus vectors may be optimal.

Expression Protocol:

  • Clone the full-length D. labrax rhodopsin gene (1-353 amino acids) into an appropriate expression vector with a C-terminal purification tag (His6 or 1D4 epitope tag)

  • Transfect mammalian cells and culture in darkness or under dim red light

  • Add 11-cis-retinal (5-10 μM) during expression to facilitate proper folding

  • Harvest cells 48-72 hours post-transfection

  • For membrane preparation, disrupt cells by sonication or nitrogen cavitation in buffer containing protease inhibitors

Purification Strategy:

  • Solubilize membranes in a detergent solution (typically 1% n-dodecyl-β-D-maltoside or CHAPS) at 4°C for 1 hour

  • Remove insoluble material by ultracentrifugation (100,000 × g for 45 minutes)

  • For His-tagged protein: purify using Ni-NTA affinity chromatography

  • For 1D4-tagged protein: use 1D4-antibody affinity chromatography

  • Elute with imidazole (His-tag) or 1D4 peptide (1D4-tag)

  • Further purify by size exclusion chromatography if higher purity is required

Critical Parameters:

  • Maintain samples at 4°C and protect from light throughout the procedure

  • Include specific additives: 100 mM NaCl, 1 mM MgCl₂, and glycerol (10-15%)

  • Adjust buffer pH to 6.0-6.5 to stabilize the rhodopsin molecule

  • Consider adding a specific concentration of lipids during purification to maintain function

How can researchers effectively study the spectral properties of recombinant Dicentrarchus labrax Rhodopsin?

Absorption Spectroscopy Protocol:

  • Prepare purified recombinant rhodopsin at 0.2-0.5 mg/ml in buffer containing 0.1% detergent

  • Record dark-state absorption spectrum (250-650 nm) using a UV-visible spectrophotometer with temperature control

  • Illuminate sample with >495 nm light to convert rhodopsin to metarhodopsin II

  • Record post-illumination spectrum

  • Calculate difference spectrum (dark minus light) to determine λmax

Research Parameters to Consider:

  • Measure absorption spectra at different temperatures (18°C, 23°C, and 28°C) to correlate with the in vivo temperature effects observed in sea bass

  • Analyze using visual pigment absorbance templates (SSH or GFRKD) and determine λmax values using maximum likelihood fitting

  • Compare with other teleost rhodopsins to identify spectral tuning residues

Spectral Sensitivity Analysis:
For functional analysis, electroretinography (ERG) can be used with spectral sensitivity data fitted to mathematical models of visual pigment absorbance templates:

  • Apply either Stavenga, Smits and Hoenders (SSH) or Govardovskii, Fyhrquist, Reuter, Kuzmin and Donner (GFRKD) vitamin A1 rhodopsin absorbance templates

  • Derive estimates of unknown model parameters (λmax values and weighting proportions) using maximum likelihood

  • Select the appropriate template and number of contributing pigments using Akaike's information criterion

What methods can be used to study the effect of temperature on Dicentrarchus labrax Rhodopsin?

Temperature-Dependent Expression Analysis:

  • Acclimate juvenile European seabass to different temperatures (e.g., 18°C, 23°C, and 28°C) for at least 30 days

  • Extract retinal tissue and isolate total RNA using TRI Reagent or similar

  • Synthesize cDNA using reverse transcriptase

  • Perform quantitative PCR (qPCR) to measure rhodopsin mRNA abundance

  • Normalize gene expression to appropriate reference genes stable across temperature conditions

Protein Stability and Function Analysis:

  • Express and purify recombinant rhodopsin as described earlier

  • Conduct thermal stability assays by:

    • Incubating purified protein at different temperatures (18-30°C)

    • Monitoring A500 nm absorbance over time to assess chromophore stability

    • Analyzing thermal denaturation profiles using differential scanning calorimetry

Membrane Environment Analysis:
Given the significant temperature-induced changes in lipid composition of the sea bass retina, analysis of protein-lipid interactions is crucial:

  • Extract retinal lipids from fish acclimated to different temperatures

  • Analyze lipid profiles using thin-layer chromatography and gas chromatography

  • Reconstitute purified rhodopsin in native lipid compositions from different temperature conditions

  • Measure spectral and functional properties in these different lipid environments

How can researchers investigate the structure-function relationship in Dicentrarchus labrax Rhodopsin using site-directed mutagenesis?

Mutagenesis Strategy:

  • Identify key residues for mutation based on:

    • Sequence alignment with well-characterized rhodopsins

    • Homology modeling using crystal structures of bovine or squid rhodopsin

    • Residues unique to D. labrax rhodopsin that may relate to environmental adaptation

  • Design mutagenesis primers to create single or multiple mutations

  • Perform site-directed mutagenesis using PCR-based methods

  • Verify mutations by DNA sequencing

Functional Analysis of Mutants:

  • Express wild-type and mutant proteins under identical conditions

  • Compare spectral properties, particularly:

    • Absorption maximum (λmax)

    • Rate of Meta II formation and decay

    • Thermal stability at different temperatures (18°C, 23°C, and 28°C)

  • Assess G-protein activation efficiency using in vitro G-protein activation assays

Key Residues to Consider:

  • Counterion residues that stabilize the protonated Schiff base

  • Residues in the retinal binding pocket that determine spectral tuning

  • Transmembrane domain residues that may influence temperature sensitivity

Researchers should systematically compare mutant properties with wild-type rhodopsin across different temperatures to understand the molecular basis of temperature adaptation in D. labrax visual system .

What approaches can be used to investigate how environmental factors affect Dicentrarchus labrax Rhodopsin function?

Temperature-Dependent Lipid Environment Studies:
The significant temperature-induced redistribution of fatty acids observed in D. labrax retina suggests complex membrane adaptations that may affect rhodopsin function. Researchers can:

  • Compare rhodopsin function in membranes with different lipid compositions:

    • Reconstruct lipid bilayers mimicking the compositions found at 18°C, 23°C, and 28°C

    • Measure rhodopsin photocycle kinetics and activation properties in each environment

    • Correlate changes in neutral lipid/polar lipid ratios with functional parameters

  • Analyze specific lipid-protein interactions:

    • Use mass spectrometry to identify lipids that co-purify with rhodopsin

    • Perform molecular dynamics simulations to model how different lipid environments affect protein structure and dynamics

    • Test the effect of specific docosahexaenoic acid (DHA) content on rhodopsin stability and function

Dietary Factor Analysis:
Based on the evidence that dietary factors affect visual function in European sea bass:

  • Design experiments to investigate the effect of dietary taurine levels on:

    • Rhodopsin expression

    • Spectral sensitivity

    • Photoreceptor health and visual function

  • Use electrophysiological methods such as electroretinography (ERG) to assess visual function under different environmental conditions

What are the most effective cell-based systems for studying recombinant Dicentrarchus labrax Rhodopsin?

Mammalian Cell Expression Systems:
HEK293 and COS-7 cells are commonly used for GPCR expression and offer:

  • Proper post-translational modifications

  • Correct folding and membrane targeting

  • Compatibility with functional assays

Fish Cell Lines:
The Dicentrarchus labrax Embryonic Cell Line (DLEC) presents a unique opportunity for homologous expression:

  • DLEC Cell Culture Protocol:

    • Maintain cells at 22°C in sealed flasks with Liebovitz's L15 medium

    • Supplement with 10% heat-inactivated FBS and adjust osmolarity by adding 5 μl/ml of 3M NaCl

    • Split cells every ~72 hours when semi-confluent

    • Use minimal amounts of trypsin-EDTA after two PBS washes

  • Advantages of DLEC for Rhodopsin Research:

    • Native cellular environment from the same species

    • Temperature-appropriate culture conditions (22°C)

    • Potential expression of species-specific chaperones and folding machinery

  • Comparison with Other Systems:

    • DLEC may provide more physiologically relevant results than mammalian cells

    • Lower protein yields but potentially higher functional relevance

    • Allows study of species-specific protein-protein interactions

How can recombinant Dicentrarchus labrax Rhodopsin be used to study climate change impacts on fish visual systems?

The temperature-dependent properties of D. labrax rhodopsin make it an excellent model for studying how climate change might affect fish visual systems :

Research Methodology:

  • Conduct comparative studies of rhodopsin properties across temperature ranges matching climate change projections:

    • Current average temperatures (e.g., 18-23°C)

    • Projected elevated temperatures (e.g., 25-30°C)

  • Analyze temperature-dependent molecular adaptations:

    • Changes in rhodopsin expression levels

    • Alterations in retinal fatty acid composition

    • Shifts in membrane lipid distribution between neutral and polar lipids

  • Correlate molecular changes with visual function:

    • Use ERG to measure spectral sensitivity under different temperature regimes

    • Assess impacts on dim-light vision

    • Determine threshold detection limits at different temperatures

Data Table: Temperature Effects on D. labrax Retina and Rhodopsin

Parameter18°C23°C28°CPotential Impact on Vision
Rhodopsin mRNADecreasedModerateIncreasedAltered photoreceptor density
Neutral LipidsIncreasedModerateDecreasedChanged membrane fluidity
Polar LipidsDecreasedModerateIncreasedModified signaling efficiency
DHA ContentIncreasedModerateNo significant changeImpacts on photoreceptor membrane function
FADS2/ELOVL5 mRNAHighestModerateLowestAltered fatty acid metabolism
PLA2 mRNALowerHighestLowerModified phospholipid turnover

This research has significant ecological implications as vision plays a critical role in prey capture, predator avoidance, and reproduction in fish species .

How can researchers integrate rhodopsin studies with broader visual system research in Dicentrarchus labrax?

Comprehensive Visual System Analysis:

  • Combine rhodopsin molecular studies with:

    • Retinal morphology and ultrastructure analysis

    • Photoreceptor density and distribution mapping

    • Visual pigment expression patterns across the retina

    • Full-spectrum electroretinography

  • Correlate molecular data with behavioral studies:

    • Prey detection and capture efficiency at different light intensities

    • Predator avoidance responses

    • Circadian activity patterns

Integration with Melatonin Pathway Research:
Research has shown that temperature affects rhodopsin expression but not the mRNA levels of melatonin synthesis enzymes . Researchers can:

  • Investigate the relationship between rhodopsin and melatonin:

    • Study how rhodopsin-mediated light detection influences melatonin production

    • Examine whether temperature affects post-transcriptional regulation of melatonin synthesis enzymes

    • Analyze the role of rhodopsin in circadian rhythm entrainment

  • Explore the interdependence of visual and non-visual photoreception:

    • Characterize non-visual opsins in D. labrax

    • Compare temperature sensitivity of visual vs. non-visual photoreception

What challenges exist in maintaining functional integrity of recombinant Dicentrarchus labrax Rhodopsin and how can they be addressed?

Common Challenges and Solutions:

  • Light Sensitivity:

    • Challenge: Photobleaching during expression and purification

    • Solution: Perform all procedures under dim red light (>650 nm) or in darkness

  • Thermal Stability:

    • Challenge: Denaturation and loss of chromophore at higher temperatures

    • Solution: Maintain strict temperature control during purification (4-8°C); use glycerol (15%) as stabilizer

  • Detergent Selection:

    • Challenge: Detergent-induced conformational changes

    • Solution: Screen multiple detergents (DDM, CHAPS, digitonin); include cholesterol hemisuccinate as stabilizer

  • Retinal Isomerization:

    • Challenge: Spontaneous isomerization of 11-cis-retinal during long experiments

    • Solution: Add hydroxylamine to trap free retinal; conduct time-limited experiments

  • Lipid Environment:

    • Challenge: Loss of native lipid interactions during purification

    • Solution: Add specific phospholipids during purification; reconstitute in nanodiscs or lipid vesicles with compositions matching D. labrax retinal membranes

  • Species-Specific Temperature Adaptations:

    • Challenge: Standard protocols may not account for temperature optima of D. labrax proteins

    • Solution: Adjust purification and assay temperatures to match physiological range (18-28°C); test functional properties across this temperature range

Advanced Stabilization Techniques:

  • Nanobody or antibody fragment co-purification to stabilize specific conformations

  • Addition of specific fatty acids (particularly DHA) that are abundant in the native retina

  • Use of directed evolution to identify more stable variants for structural studies

What emerging technologies could advance the study of Dicentrarchus labrax Rhodopsin?

Cryo-Electron Microscopy (Cryo-EM):

  • Potential for high-resolution structural determination of D. labrax rhodopsin without crystallization

  • Ability to capture different conformational states during photoactivation

  • Opportunity to visualize temperature-dependent structural changes

Optogenetics and Chemogenetics:

  • Development of D. labrax rhodopsin-based optogenetic tools

  • Creation of chimeric proteins combining sea bass rhodopsin with other signaling domains

  • In vivo manipulation of neural circuits using modified rhodopsins

Advanced Spectroscopic Techniques:

  • Time-resolved crystallography to capture photointermediates

  • Ultrafast spectroscopy to monitor conformational changes

  • Single-molecule fluorescence to track rhodopsin dynamics in native-like membranes

CRISPR/Cas9 Gene Editing:

  • Creation of transgenic sea bass with modified rhodopsin for in vivo studies

  • Development of rhodopsin knock-in/knock-out models to study visual adaptation

  • Introduction of reporter-tagged rhodopsin for real-time visualization in living fish

AI-Based Computational Approaches:

  • AlphaFold or similar AI tools to predict temperature-dependent structural changes

  • Molecular dynamics simulations in different lipid environments and temperatures

  • Systems biology modeling of the complete visual transduction pathway

These emerging technologies could provide unprecedented insights into how temperature affects rhodopsin structure and function, with implications for understanding climate change impacts on fish visual systems .

How might the study of Dicentrarchus labrax Rhodopsin contribute to comparative visual physiology?

Evolutionary Adaptations Research:
European seabass rhodopsin represents an excellent model for studying evolutionary adaptations in visual systems due to:

  • Its adaptation to variable temperature environments (18-28°C)

  • The well-documented effects of temperature on its expression and potentially function

  • The species' ecological significance in marine ecosystems

Comparative studies could:

  • Analyze rhodopsin sequences across fish species from different thermal habitats

  • Identify specific amino acid substitutions associated with cold or warm adaptation

  • Compare spectral tuning mechanisms between deep-sea and shallow-water species

Cross-Species Comparison Framework:
Researchers could develop a standardized framework for comparing rhodopsin properties across species:

  • Spectral sensitivity (λmax values)

  • Thermal stability parameters

  • Membrane lipid requirements

  • Photobleaching and regeneration kinetics

  • G-protein coupling efficiency

This framework would facilitate direct comparisons between D. labrax rhodopsin and rhodopsins from:

  • Other teleost fish from different thermal habitats

  • Mammals and other vertebrates

  • Invertebrates with rhodopsin-like photopigments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.