Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase and Subunit a (atpB)

ATP synthases are membrane-bound enzymes critical for generating ATP via proton motive force (PMF) across bacterial cell membranes. In Gram-negative bacteria like Dichelobacter nodosus, the enzyme comprises two main sectors:

  • F₁: Catalytic headpiece (responsible for ATP synthesis/hydrolysis).

  • F₀: Proton-conducting transmembrane domain (subunits a and c).

Subunit a (atpB) is a hydrophobic, transmembrane protein essential for proton translocation and energy coupling. It forms part of the stator structure, stabilizing the F₀ sector and interacting with the rotating c-ring .

Dichelobacter nodosus and Its ATP Synthase

D. nodosus is a Gram-negative, anaerobic pathogen causing ovine foot rot. While its virulence is primarily linked to proteases (e.g., AprV2) and fimbriae, ATP synthase subunits like atpB are critical for cellular energy production.

CharacteristicDetail
TaxonomyCardiobacteriaceae family, Dichelobacter genus .
Pathogenic RoleATP synthase sustains metabolic activity; no direct virulence association reported .
Genomic ContextatpB gene identified in D. nodosus JKS-07B serogroup B isolate genome .

Recombinant Production of D. nodosus atpB

Recombinant atpB is produced via heterologous expression in E. coli, often with His-tagged fusion partners for purification.

Functional Studies

  • Proton Translocation: Subunit a interacts with c-ring subunits to drive rotation during ATP synthesis .

  • Stoichiometry: Bacillus studies suggest a 10–14 c-subunit ring; D. nodosus may share similar architecture .

Antimicrobial Targeting

ATP synthase inhibitors (e.g., efrapeptins) disrupt bacterial energy metabolism. Recombinant atpB could aid in screening for novel inhibitors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize developing it.
Synonyms
atpB; DNO_1148; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Dichelobacter nodosus (strain VCS1703A)
Target Names
atpB
Target Protein Sequence
MATGGEMTSAEIIHHHMVNLTVGEGFWALHLDTLFFSILLGCSFCWLFYSIGKKAESGVP GFAQNVAEMVFDFIDNTVKGFFGESRSDIGSLALTLFCWIFFWNVMDLIPVDLLPSMAKL IGIPYLKIVPSTDPNATFALSISVVLITLVYTFRNNHGLLGMLRAMGTHPFESSGLIGKI LLFPANFALRIVEDMAKIVSLSLRLFGNLFAGEIVFILITFLPFWSQWVPGGAWAIFHIL VVTLQAYVFMILTIVYMSMVEKH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Dichelobacter nodosus?

ATP synthase subunit a (atpB) is a critical component of the F0 sector of the mitochondrial F-type ATP synthase complex in D. nodosus. This protein plays an essential role in coupling proton translocation to the rotary motion of the enzyme, which is fundamental for ATP production. The F-type ATP synthase is a multisubunit nanomotor that maintains cellular ATP levels necessary for the organism's survival and virulence . In D. nodosus, as in other bacterial species, the F0 sector components form part of the peripheral stalk (stator) that stabilizes the non-rotating parts of the enzyme during ATP synthesis.

How does the genetic sequence of atpB in D. nodosus compare to other bacterial species?

Dichelobacter nodosus, like other specialized pathogens, exhibits significant genetic divergence in many of its proteins compared to model organisms. While specific data on atpB sequence divergence is not detailed in the provided search results, genomic analysis of D. nodosus reveals approximately 98.63% sequence homology with the reference genome VCS1703A . The genome of D. nodosus is approximately 1,311,533 bp, with about one-fifth believed to have been acquired through lateral gene transfer . This suggests that components like atpB may have distinctive features that reflect the organism's evolutionary adaptation to its specialized niche as a footrot pathogen.

What expression systems are most suitable for producing recombinant D. nodosus proteins?

A methodological approach would include:

  • Gene synthesis or PCR amplification of the atpB gene from D. nodosus genomic DNA

  • Cloning into an expression vector with appropriate promoters and fusion tags

  • Transformation into an E. coli strain optimized for membrane protein expression

  • Induction under anaerobic or microaerobic conditions to mimic the natural environment of D. nodosus

  • Validation of expression using Western blotting or mass spectrometry

How can researchers distinguish between in vivo recombination and PCR recombination artifacts when studying D. nodosus genes?

Distinguishing between genuine in vivo recombination and PCR artifacts is crucial when studying genes from D. nodosus, as highlighted by research on fimbrial subunit genes . Researchers should implement the following methodological approaches:

  • Control amplifications: Perform control PCR reactions with artificially mixed genomic DNA from different serotypes to assess the baseline frequency of recombination artifacts.

  • Frequency analysis: True in vivo recombination typically shows higher frequencies than PCR artifacts, which occur at lower rates. Research has shown that PCR recombination artifacts were only observable after re-amplification, suggesting they occur at a low frequency .

  • Sequence verification: Identify specific sequence features that suggest biological recombination, such as the presence of Chi-like sequences. For example, a 14-mer sequence (5'-GCTGGTGCTGGTGA-3') consisting of two partially overlapping Chi-like sequences has been found in recombinant fragments of D. nodosus .

  • Specific primer design: Design primer sets that specifically target the recombinant junctions to verify their presence in original samples rather than as artifacts of amplification.

  • Single-strand conformation polymorphism (SSCP): Use SSCP patterns to identify novel recombinants, as demonstrated in research where novel amplimers showed SSCP patterns different from previously identified serogroups and serotypes .

What experimental design considerations are critical for studying recombinant ATP synthase subunits?

When designing experiments to study recombinant ATP synthase subunits like atpB from D. nodosus, researchers should consider:

  • Variable definition and control: Clearly define independent variables (e.g., expression conditions) and dependent variables (e.g., protein yield, folding, activity) while controlling for extraneous variables that might affect results .

  • Hypothesis formulation: Develop specific, testable hypotheses about the structure-function relationships of the atpB subunit based on its sequence and predicted structural features .

  • Treatment design: Create experimental treatments that systematically manipulate expression conditions, purification methods, or protein modifications to optimize yield and activity .

  • Comparative approach: Include ATP synthase subunits from related organisms or well-characterized model systems as positive controls and benchmarks.

  • Functional validation: Design assays to verify that the recombinant protein maintains native structural properties and can integrate into functional ATP synthase complexes.

  • Structural analysis pipeline: Plan for structural characterization using techniques such as circular dichroism, X-ray crystallography, or cryo-electron microscopy to understand the unique features of the D. nodosus atpB.

How can mass spectrometry be optimized for identification and characterization of novel ATP synthase subunits?

Mass spectrometry (MS) is a powerful tool for identifying and characterizing novel ATP synthase subunits, as demonstrated in research on apicomplexan F-type ATP synthase . For optimal results with D. nodosus atpB:

  • Sample preparation: Partially purify the monomeric (~600 kDa) and dimeric (>1 MDa) forms of the ATP synthase complex through gradient centrifugation or chromatography before MS analysis.

  • Crosslinking strategies: Implement protein crosslinking prior to purification to stabilize transient protein-protein interactions within the complex.

  • MS approach selection: Employ a combination of bottom-up and top-down proteomics approaches:

    • Bottom-up: Enzymatic digestion followed by LC-MS/MS for peptide identification

    • Top-down: Analysis of intact proteins to preserve post-translational modifications

  • Database considerations: Due to sequence divergence in D. nodosus proteins, create custom databases that include predicted protein sequences from the D. nodosus genome to improve identification rates.

  • Validation strategy: Confirm MS identifications through complementary approaches such as immunoblotting with antibodies against conserved regions or heterologous expression of identified components.

What strategies can overcome the challenges of expressing membrane proteins like atpB from fastidious anaerobes?

Expressing membrane proteins from fastidious anaerobes like D. nodosus presents significant challenges. Researchers can employ these methodological approaches:

  • Modified expression hosts: Use specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Anaerobic expression systems: Develop expression protocols under anaerobic conditions that better mimic the natural environment of D. nodosus.

  • Fusion partner optimization: Test multiple fusion partners (MBP, SUMO, Mistic) that can enhance membrane protein solubility and correct folding.

  • Detergent screening: Systematically evaluate different detergents for optimal extraction and purification of the membrane-bound atpB.

  • Cell-free expression systems: Consider cell-free protein synthesis with supplemented lipids or nanodiscs to facilitate proper folding of membrane proteins.

  • Codon optimization: Optimize the coding sequence for expression in the selected host, accounting for the significant GC content differences between D. nodosus and expression hosts.

How can researchers verify the structural integrity and functionality of recombinant atpB?

Verifying the structural integrity and functionality of recombinant atpB requires multiple complementary approaches:

  • Proton translocation assays: Develop liposome-based assays to measure the proton translocation capability of reconstituted atpB.

  • ATP synthesis measurement: Reconstitute the recombinant atpB with other ATP synthase components and measure ATP synthesis rates under a proton gradient.

  • Structural analysis: Use circular dichroism spectroscopy to assess secondary structure content and compare with predictions based on sequence analysis.

  • Interaction studies: Perform pull-down assays or surface plasmon resonance to verify interactions with other subunits of the ATP synthase complex.

  • Comparative modeling: Develop structural models based on homologous proteins from related organisms, identifying conserved functional domains despite sequence divergence.

  • Site-directed mutagenesis: Create targeted mutations in conserved residues predicted to be essential for function and assess the impact on activity.

What evidence suggests lateral gene transfer has influenced the evolution of ATP synthase components in D. nodosus?

The genomic evidence for lateral gene transfer in D. nodosus is substantial, with approximately one-fifth of its 1.3 Mb genome believed to have been acquired through lateral gene transfer, including an incorporated Mu-like bacteriophage . For ATP synthase components specifically:

  • Phylogenetic incongruence: Compare phylogenetic trees constructed from atpB sequences with species trees to identify potential horizontal gene transfer events.

  • Sequence anomalies: Analyze GC content, codon usage, and nucleotide composition of atpB relative to the rest of the genome to detect signatures of recent gene acquisition.

  • Mobile genetic elements: Investigate the genomic context of atpB for nearby mobile genetic elements, insertion sequences, or prophage remnants.

  • Comparative genomics: Compare the organization of ATP synthase operons across related species to identify synteny breaks or unusual gene arrangements that might indicate recombination events.

  • Recombination analysis: Apply algorithms specifically designed to detect recombination breakpoints within the ATP synthase operon.

How does strain variation in D. nodosus influence ATP synthase structure and function?

Strain variation in D. nodosus has significant implications for protein structure and function, including for ATP synthase components:

  • SNP and InDel analysis: Genomic analyses have identified 2,933 SNP positions and 92 InDel positions compared to reference genomes . These variations may affect protein function, including ATP synthase components.

  • Virulence correlation: The pathogenicity of D. nodosus strains correlates with approximately 40 genes compared to reference genomes . Researchers should investigate whether ATP synthase components are among these genes and how variations might relate to virulence.

  • Serogroup differences: D. nodosus exhibits significant serogroup variation, with serogroup B being predominant in virulent footrot cases in many countries . This suggests that proteins, potentially including ATP synthase components, may have structural or functional differences between serogroups.

  • Adaptation signatures: Analyze selection pressures on atpB across different strains to identify regions under positive selection that might indicate environmental adaptation.

  • Functional diversity: Develop comparative biochemical assays to assess whether strain variations lead to differences in ATP synthesis efficiency or regulation.

What potential exists for ATP synthase components as targets for novel antibiotic development?

The ATP synthase complex represents a promising target for antimicrobial development against D. nodosus:

  • Essential function: As ATP synthase is critical for cellular energy production, it represents an essential target that the pathogen cannot easily dispense with.

  • Structural uniqueness: The highly diverged novel subunit composition observed in ATP synthase complexes of some pathogens suggests the possibility of developing highly specific inhibitors with minimal off-target effects on host ATP synthases .

  • Drug design approach: Structure-based drug design could leverage the unique features of D. nodosus atpB to develop inhibitors that specifically block proton translocation or subunit interactions.

  • Combination strategy: ATP synthase inhibitors could potentially be used in combination with existing treatments for footrot in sheep.

  • Screening methodology: High-throughput screening approaches using reconstituted ATP synthase components could identify lead compounds for further development.

How might recombinant ATP synthase components be incorporated into footrot vaccines?

Recombinant ATP synthase components could potentially enhance footrot vaccine development through several approaches:

  • Subunit vaccine formulation: Recombinant atpB or other ATP synthase components could be incorporated into subunit vaccines, potentially enhancing the immune response beyond current whole-cell killed vaccines .

  • Conserved epitope targeting: Identify conserved regions within atpB across different strains to target broadly protective immune responses.

  • Adjuvant selection: Optimize adjuvant formulations specifically for recombinant membrane proteins to enhance immunogenicity while maintaining proper protein conformation.

  • Delivery system development: Explore liposome or nanoparticle-based delivery systems that can present membrane proteins in native-like lipid environments.

  • Efficacy assessment: Develop challenge models in sheep to assess the protective efficacy of recombinant ATP synthase-based vaccines compared to conventional approaches.

  • Cross-protection analysis: Evaluate whether immunity targeting ATP synthase components can provide protection across the diverse serogroups of D. nodosus that cause footrot in different regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.