Recombinant Dichelobacter nodosus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Overview of Lipoprotein Signal Peptidase (LspA)

Lipoprotein signal peptidase (LspA) is a type II signal peptidase (SPase II) critical for processing bacterial lipoproteins. These enzymes cleave the signal peptide from prolipoproteins, enabling their maturation and integration into the bacterial cell membrane. SPase II activity is essential for virulence in many Gram-negative pathogens, as lipoproteins play roles in adhesion, immune evasion, and nutrient acquisition .

Functional Role of LspA in Dichelobacter nodosus

Dichelobacter nodosus, the causative agent of ovine footrot, relies on virulence factors such as type IV fimbriae and extracellular proteases (e.g., AprV2). While lspA has not been directly characterized in D. nodosus, genomic studies reveal conserved secretory pathways:

  • Secretory Proteins: D. nodosus possesses 89 secretory proteins, with 14 predicted as lipoproteins .

  • Transcriptional Patterns: In related bacteria (e.g., Rickettsia typhi), lspA and lgt (prolipoprotein transferase) show coordinated expression during infection, peaking during active intracellular growth .

Recombinant LspA: Expression and Functional Validation

Though recombinant D. nodosus LspA is not explicitly documented, studies on homologous systems provide insights:

  • Globomycin Resistance Assays: Overexpression of lspA in Escherichia coli confers resistance to globomycin, an antibiotic that inhibits SPase II. This assay confirms enzymatic activity, as seen with R. typhi LspA .

  • Complementation Studies: R. typhi LspA partially restores growth in E. coli SPase II mutants, demonstrating functional conservation despite low sequence identity (~22%) .

Comparative Analysis of SPase II Activity

FeatureD. nodosus (Predicted)Rickettsia typhiEscherichia coli
Gene IdentityNot sequenced100% (Native)100% (Native)
Globomycin ResistanceNot testedIncreased resistance Native resistance
Protease LinkageIndirect (via AprV2) Not observedNot observed

Research Gaps and Future Directions

  • Genomic Characterization: The D. nodosus genome (e.g., strain JKS-07B) contains 21 unique genes compared to reference strains, but lspA remains unannotated .

  • Functional Studies: Recombinant D. nodosus LspA could clarify its role in lipoprotein processing and virulence. Current studies focus on fimbriae (fimA) and proteases (aprV2), which are toxic when expressed in E. coli .

  • Vaccine Development: Recombinant fimbrial proteins (e.g., FimA) fail to assemble in E. coli but elicit immune responses, suggesting similar challenges for LspA-based vaccines .

Key Findings from Related Recombinant Studies

  1. Toxicity of Recombinant Proteins:

    • D. nodosus fimbrial subunits (fimA) disrupt E. coli membrane integrity, necessitating induced expression systems .

    • Similar toxicity might occur with recombinant LspA due to hydrophobic domains .

  2. Protease Virulence:

    • A single amino acid substitution (Tyr92Arg) in AprV2 distinguishes virulent (aprV2) from benign (aprB2) strains .

    • SPase II could indirectly influence protease secretion, as seen in R. typhi .

Implications for Footrot Pathogenesis

  • Adhesion and Invasion: Type IV fimbriae, regulated by PilR/S and σ54, require proper lipoprotein processing for assembly .

  • Protease Secretion: Reduced SPase II activity in mutants correlates with diminished extracellular protease levels, linking lipoprotein processing to tissue degradation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; DNO_0084; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Dichelobacter nodosus (strain VCS1703A)
Target Names
lspA
Target Protein Sequence
MNWAKRSAFFLISVACFLADYYSKYWALTELGARKIVVNTYMNFILAFNHGAAFSFLARA GGWQRWLFAGFAGIVALWLIMTLLTKSHHWLMSVSYACILGGAVGNLYDRVVYGYVIDFI QWHYRTFYWPVFNLADVAITLGVILMLIAELHRR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic functional role of LspA in bacterial physiology?

LspA serves as an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins as part of the essential lipoprotein-processing pathway in bacteria. This enzymatic activity is crucial for proper lipoprotein maturation, which affects various bacterial functions including signal transduction, stress sensing, virulence, cell division, nutrient uptake, adhesion, and activation of host immune responses . In particular, D. nodosus LspA plays a critical role in the pathophysiology of footrot, a contagious disease affecting the digits of ruminants worldwide . The enzyme contains a catalytic dyad of aspartate residues in its active site that facilitates the cleavage reaction, and its activity is essential for bacterial survival, especially in Gram-negative bacteria like Escherichia coli and Salmonella enterica .

How does LspA's structure contribute to its substrate specificity?

LspA exhibits remarkable structural plasticity that enables it to accommodate and process a variety of lipoprotein substrates. The enzyme contains a periplasmic helix (PH) and a β-cradle structure that together form a dynamic "clamp" mechanism crucial for substrate binding and catalysis . Molecular dynamics simulations and electron paramagnetic resonance (EPR) studies have revealed that the periplasmic helix fluctuates on the nanosecond timescale, sampling multiple conformations that affect active site accessibility . In the apo (substrate-free) state, the dominant conformation is closed, with the periplasmic helix occluding the charged active site from the lipid bilayer, while minor open conformations partially expose the active site to allow substrate binding . This conformational flexibility explains how LspA can accommodate structurally diverse lipoprotein substrates while maintaining specificity for signal peptide cleavage.

What experimental approaches are most effective for initial characterization of recombinant LspA?

For initial characterization of recombinant D. nodosus LspA, a multi-technique approach is recommended:

  • Gene Amplification and Sequencing: PCR amplification of the LspA gene using primers based on conserved regions, followed by sequencing to verify the gene identity and identify strain-specific variations .

  • Recombinant Expression Systems: Expression in E. coli using membrane protein-specific vectors with affinity tags (His6 or FLAG) for purification.

  • Structural Analysis: X-ray crystallography and cryo-electron microscopy for high-resolution structural determination, as successfully applied to LspA from Staphylococcus aureus and Pseudomonas aeruginosa .

  • Functional Assays: Developing in vitro protease activity assays using fluorescently labeled lipoprotein substrates to measure enzymatic activity.

  • Biophysical Characterization: Circular dichroism spectroscopy for secondary structure analysis and thermal stability assessment of the recombinant protein.

TechniqueApplicationInformation Obtained
PCR and SequencingGene identificationSequence variations, strain typing
X-ray CrystallographyStructural determinationHigh-resolution 3D structure
Molecular DynamicsConformational analysisDynamic behavior, substrate binding models
EPR SpectroscopyConformational dynamicsNanosecond timescale movements
Protease Activity AssaysFunctional analysisKinetic parameters, inhibitor screening

How do researchers investigate the conformational changes of LspA upon substrate or inhibitor binding?

Investigating LspA conformational dynamics requires sophisticated biophysical approaches. Current research employs a hybrid methodology combining molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) spectroscopy . This dual approach provides complementary insights that neither method alone can achieve.

For MD simulations, researchers typically:

  • Build atomic models of LspA embedded in lipid bilayers mimicking bacterial membranes

  • Run extensive simulations (hundreds of nanoseconds to microseconds) under physiological conditions

  • Analyze trajectories to identify conformational states and transitions

  • Calculate energy landscapes to determine the stability of different conformations

For experimental validation using EPR:

  • Introduce spin labels at strategic positions along the periplasmic helix and β-cradle

  • Perform continuous wave (CW) EPR to measure nanosecond timescale dynamics

  • Use double electron-electron resonance (DEER) to measure distances between spin labels

  • Compare distance distributions in apo state versus inhibitor-bound states

Research has revealed that LspA's periplasmic helix fluctuates on the nanosecond timescale and samples three distinct conformational states: closed, intermediate, and open . In the apo state, the dominant conformation is closed, occluding the charged active site from the lipid bilayer. With antibiotic inhibitors like globomycin bound, the periplasmic helix adopts a more open conformation, with multiple binding modes observed . The different conformations observed in both bound and apo states indicate a flexible and adaptable active site architecture.

What computational approaches best predict LspA-substrate interactions for D. nodosus variants?

For predicting LspA-substrate interactions across D. nodosus variants, researchers should implement:

  • Homology Modeling: Generate D. nodosus LspA structural models based on crystal structures from related bacteria like S. aureus (LspMrs) and P. aeruginosa (LspPae) .

  • Active Site Mapping: Identify conserved catalytic residues and substrate-binding regions through multiple sequence alignments and structural superposition.

  • Molecular Docking: Perform docking simulations of lipoprotein signal peptides to predict binding modes and interaction energies.

  • Molecular Dynamics Simulations: Run extended (>500 ns) simulations to:

    • Sample conformational space of the enzyme-substrate complex

    • Identify stable binding modes

    • Calculate binding free energies using methods like MM-PBSA or FEP

    • Analyze hydrogen bonding patterns and hydrophobic interactions

  • Machine Learning Approaches: Develop models trained on existing LspA-substrate interaction data to predict binding affinities for novel variants.

A recent study demonstrated that MD simulations successfully identified multiple conformational states of LspA that were not observed in crystal structures alone . This approach revealed that the open conformation is the only one that could sterically accommodate the prolipoprotein substrate in the active site with the correct orientation for signal peptide cleavage . Similar methods can be applied to D. nodosus LspA variants to predict how sequence variations might affect substrate specificity and catalytic efficiency.

How do antibiotics like globomycin modify LspA's conformational landscape?

Antibiotic binding significantly reshapes LspA's conformational landscape, as revealed by structural and dynamic studies . Globomycin and myxovirescin, despite having different molecular structures, inhibit LspA through a similar mechanism by mimicking a tetrahedral reaction intermediate .

Specifically:

  • Conformational Selection: Antibiotics stabilize an intermediate conformation of the periplasmic helix, different from both the fully closed (apo) and fully open (substrate-binding) states .

  • Active Site Occlusion: Crystal structures show that globomycin binds directly to the catalytic dyad, preventing substrate access and catalysis .

  • Altered Dynamic Equilibrium: EPR data reveals that globomycin-bound LspA exhibits multiple distance populations between the periplasmic helix and β-cradle, indicating it samples multiple conformational states with different probabilities than the apo enzyme .

  • Convergent Binding Mechanism: Despite structural differences, globomycin and myxovirescin share a common 19-atom motif that interacts similarly with LspA, recapitulating part of the substrate lipoprotein binding mode .

The conformational shift induced by antibiotics prevents both substrate binding and catalysis, effectively inhibiting LspA function. Importantly, molecular dynamics simulations suggested that while LspA samples all three conformational states (closed, intermediate, and open) in all conditions, the population distribution varies significantly between apo and antibiotic-bound states . This conformational plasticity explains how different antibiotics can effectively inhibit the enzyme despite having distinct chemical structures.

What are the optimal conditions for expressing and purifying recombinant D. nodosus LspA?

Expression and purification of recombinant membrane proteins like D. nodosus LspA require specialized protocols:

Expression System Recommendations:

  • Use E. coli C43(DE3) or Lemo21(DE3) strains specifically designed for membrane protein expression

  • Employ vectors with tunable promoters (e.g., pET28a with T7lac promoter)

  • Include C-terminal His6-tag for purification, avoiding N-terminal tags that might interfere with membrane insertion

  • Induce expression at lower temperatures (18-20°C) with reduced IPTG concentration (0.1-0.3 mM)

  • Extend expression time to 16-20 hours for proper membrane insertion

Purification Protocol:

  • Cell lysis using mechanical disruption (French press or sonication)

  • Membrane fraction isolation by differential centrifugation

  • Solubilization with mild detergents (recommended: n-dodecyl-β-D-maltoside or LMNG)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for final purification and buffer exchange

Buffer Compositions:

StepBuffer CompositionPurpose
Lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitorsCell disruption while maintaining protein stability
SolubilizationLysis buffer + 1% DDM or 1% LMNG, 4 hours at 4°CMembrane protein extraction
IMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 20-250 mM imidazole gradientAffinity purification
Size Exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDMFinal purification and buffer exchange

For functional studies, the purified protein should be reconstituted into proteoliposomes or nanodiscs to maintain native-like membrane environment, which is crucial for preserving LspA's conformational dynamics as observed in molecular dynamics studies .

What molecular techniques are most reliable for identifying strain variations in D. nodosus LspA?

For characterizing strain variations in D. nodosus LspA, researchers should employ a combinatorial approach of genetic and proteomic techniques:

  • PCR Amplification and Sequencing:

    • Design primers targeting conserved regions flanking the LspA gene

    • Use high-fidelity polymerases to minimize amplification errors

    • Perform direct sequencing of PCR products for initial strain identification

  • Single-Strand Conformational Polymorphism (SSCP) Analysis:

    • An effective method for rapidly screening genetic variations

    • Successfully used to identify novel D. nodosus strains in previous studies

    • Can detect sequence variations that alter DNA mobility in non-denaturing gels

  • Restriction Fragment Length Polymorphism (RFLP):

    • Digest PCR products with restriction enzymes that target polymorphic sites

    • Analyze fragment patterns to identify strain-specific variations

    • Useful for rapid screening of multiple samples

  • Next-Generation Sequencing (NGS):

    • Whole-genome sequencing for comprehensive genetic characterization

    • RNA-Seq to analyze expression patterns of LspA across strains

    • Targeted amplicon sequencing for deep coverage of the LspA gene region

  • Mass Spectrometry-Based Proteomics:

    • Identify post-translational modifications and protein sequence variations

    • Compare tryptic peptide maps across different strains

    • Quantify expression levels in different growth conditions

These techniques have successfully identified novel D. nodosus strains. For example, in a German study, SSCP analysis of fimA gene PCR amplicons revealed three distinct banding patterns, leading to the identification of two new D. nodosus strains (B(de1) and H(de1)) . Similarly, another study identified novel fimbrial subunit genes through PCR amplification followed by SSCP analysis and sequencing .

How can researchers effectively measure LspA inhibition by potential antimicrobial compounds?

Developing robust assays for measuring LspA inhibition is critical for antibiotic discovery. Researchers should consider implementing:

  • Fluorescence-Based Protease Assays:

    • Design fluorogenic peptide substrates mimicking LspA cleavage sites

    • Measure fluorescence change upon cleavage (increased signal with FRET-based quenched substrates)

    • Calculate IC50 values for inhibitory compounds

    • Advantage: High throughput and real-time monitoring

  • Mass Spectrometry-Based Activity Assays:

    • Use synthetic lipoprotein peptides as substrates

    • Quantify substrate and product peaks by LC-MS/MS

    • Determine inhibition constants through detailed kinetic analysis

    • Advantage: Direct measurement of native substrate processing

  • Thermal Shift Assays (TSA):

    • Measure protein stabilization upon inhibitor binding

    • Use differential scanning fluorimetry with membrane-compatible dyes

    • Screen compounds based on melting temperature shifts

    • Advantage: Requires minimal protein and is amenable to high-throughput screening

  • Surface Plasmon Resonance (SPR):

    • Immobilize LspA on sensor chips using appropriate capture strategies

    • Measure direct binding of inhibitor candidates

    • Determine association and dissociation kinetics

    • Advantage: Label-free detection of binding events

  • Computational Screening and Validation:

    • Virtual screening against the active site based on known inhibitors like globomycin

    • Focus on compounds that target the 19-atom motif shared between globomycin and myxovirescin

    • Validate hits through experimental assays above

Assay TypeMeasurementAdvantagesLimitations
Fluorogenic SubstrateFluorescence increaseHigh throughput, real-timeArtificial substrate
Mass SpectrometryDirect product quantificationNative substrate processingLower throughput
Thermal ShiftΔTm upon bindingMinimal protein requiredIndirect measure of inhibition
Surface Plasmon ResonanceDirect binding kineticsLabel-free, kinetic dataRequires protein immobilization
Cellular AssaysBacterial growth inhibitionPhysiological relevanceMultiple targets possible

Crystal structures of LspA from S. aureus in complex with globomycin and myxovirescin provide valuable templates for structure-based inhibitor design . These structures revealed that despite their different chemical structures, both antibiotics inhibit LspA by mimicking a tetrahedral reaction intermediate, suggesting that effective inhibitors should target the catalytic dyad while incorporating elements of the identified 19-atom motif .

Why is D. nodosus LspA considered a promising target for footrot treatment?

D. nodosus LspA represents an excellent therapeutic target for footrot treatment for several compelling reasons:

  • Essential Pathway: LspA is part of the lipoprotein-processing pathway, which is crucial for bacterial cell envelope integrity and function . Targeting this pathway compromises the bacteria's ability to maintain proper membrane structure.

  • Role in Virulence: Proper lipoprotein processing is critical for bacterial virulence. Lipoproteins perform essential functions including signal transduction, stress sensing, cell division, nutrient uptake, and adhesion . Inhibiting LspA would disrupt these processes, potentially reducing D. nodosus virulence.

  • No Mammalian Homologs: LspA has no mammalian homologs , which significantly reduces the risk of host toxicity for any drugs targeting this enzyme. This characteristic is particularly valuable for veterinary applications.

  • Resistance Challenges: Developing resistance to LspA inhibitors is challenging for bacteria because the extensive conservation of active site residues means that mutations affecting inhibitor binding would likely also interfere with substrate binding and catalysis . This built-in resistance hardiness makes LspA an attractive long-term target.

  • Strain Coverage: While D. nodosus exhibits strain variation , LspA's catalytic mechanism is highly conserved, suggesting that targeted therapeutics could potentially address multiple strains simultaneously, including newly identified variants like B(de1) and H(de1) .

  • Accessible Active Site: The active site of LspA is accessible from the outer surface of the inner membrane , making it pharmacologically tractable for drug delivery without needing to cross multiple membrane barriers.

  • Structural Data Available: High-resolution crystal structures of LspA from related bacteria provide templates for homology modeling and structure-based drug design targeting D. nodosus LspA .

These attributes collectively make D. nodosus LspA an ideal target for developing novel treatments for footrot that could potentially overcome the limitations of current therapeutic approaches.

How do the conformational dynamics of LspA inform antibiotic design strategies?

Understanding LspA's conformational dynamics provides crucial insights for rational antibiotic design:

  • Multiple Conformational States: Research has identified three major conformational states of LspA (closed, intermediate, and open), each with distinct functional roles . Effective inhibitors must account for this conformational plasticity.

  • State-Specific Targeting: Different antibiotics stabilize distinct conformational states. Globomycin and myxovirescin preferentially stabilize an intermediate conformation of the periplasmic helix , preventing both substrate binding and catalysis.

  • Common Inhibitory Motif: Despite structural differences, globomycin and myxovirescin share a remarkable 19-atom motif that interacts similarly with LspA . This motif recapitulates part of the substrate lipoprotein binding mode and represents a critical pharmacophore for inhibitor design.

  • Active Site Accessibility: The conformational dynamics affect active site accessibility. In the apo state, the dominant closed conformation occludes the charged active site from the lipid bilayer , suggesting that effective inhibitors must either bind to transient open states or induce conformational changes to access the active site.

  • Catalytic Dyad Targeting: Both globomycin and myxovirescin interact directly with the catalytic dyad aspartate residues , indicating that effective inhibitors should form similar interactions while incorporating the identified 19-atom motif.

  • Resistance Considerations: The conformational flexibility of LspA suggests that inhibitors binding across multiple conformational states or stabilizing non-functional conformations may face higher barriers to resistance development.

  • Structure-Based Design Strategy:

    • Focus on compounds that mimic tetrahedral reaction intermediates

    • Incorporate the shared 19-atom motif identified in globomycin and myxovirescin

    • Design flexible linkers that can accommodate the conformational dynamics

    • Include lipophilic moieties that facilitate membrane insertion and targeting

This detailed understanding of LspA dynamics provides a blueprint for developing novel antibiotics with built-in resistance hardiness by targeting conserved elements essential for both inhibitor and substrate binding .

What challenges must be overcome in developing LspA inhibitors for D. nodosus?

Developing effective LspA inhibitors for D. nodosus faces several significant challenges:

  • Membrane Protein Targeting: LspA is a membrane-embedded enzyme, presenting difficulties for inhibitor design due to the need for compounds that can:

    • Access the active site from the aqueous periplasmic space or membrane interface

    • Balance hydrophobicity for membrane penetration with hydrophilicity for solubility

    • Maintain stability in the membrane environment

  • Strain Variation: D. nodosus exhibits genetic diversity across strains, with novel variants continuing to emerge . Inhibitors must target highly conserved features to maintain efficacy across different strains.

  • Selectivity Considerations: While D. nodosus-specific treatments might be desired to preserve beneficial microbiota, the high conservation of LspA's active site may make species selectivity challenging.

  • Pharmacokinetic Challenges: For footrot treatment, inhibitors must:

    • Penetrate infected hoof tissue

    • Remain stable in the challenging environment between hoof layers

    • Achieve sufficient local concentration for efficacy

    • Withstand exposure to environmental factors (mud, water, manure)

  • Delivery Formulation: Developing appropriate topical formulations for hoof application that ensure adequate contact time and penetration.

  • Testing Limitations: D. nodosus is an anaerobic bacterium that is challenging to culture in laboratory settings, complicating high-throughput screening efforts.

  • Structural Knowledge Gaps: While crystal structures of LspA from other bacteria provide valuable templates , a D. nodosus-specific structure would enhance inhibitor design precision.

  • Validation Requirements: Demonstrating efficacy requires:

    • In vitro enzyme inhibition assays

    • Bacterial growth inhibition studies

    • Ex vivo hoof infection models

    • Clinical trials in affected ruminants

Despite these challenges, the critical role of LspA in bacterial viability and virulence, combined with the identifying features of effective inhibitors from structural studies of globomycin and myxovirescin binding , provide a solid foundation for therapeutic development targeting D. nodosus LspA for footrot treatment.

How should researchers interpret contradictory data on LspA conformational states?

Contradictory data on LspA conformational states is common due to the dynamic nature of this membrane protein. Researchers should approach such discrepancies through:

  • Multi-technique Validation: No single technique captures the full conformational landscape of LspA. Researchers should triangulate findings using complementary methods:

    • Crystal structures provide static snapshots but may miss transient states

    • MD simulations sample conformational space but require experimental validation

    • EPR spectroscopy provides dynamic information but with lower resolution

    • NMR offers atomic-level dynamics but is challenging for membrane proteins

  • Context-Dependent Analysis: Contradictions often stem from different experimental conditions:

    • Detergent vs. lipid environments significantly affect conformational distributions

    • Temperature and pH influence conformational equilibria

    • Timescales of different techniques (ns for MD, μs-ms for NMR) capture different dynamics

  • Ensemble Perspective: Rather than seeking a single "correct" conformation, adopt an ensemble view:

    • LspA exists as a dynamic equilibrium between multiple states

    • Different experimental conditions may shift this equilibrium

    • Functional interpretations should consider the entire conformational landscape

  • Example Approach to Contradictions: A study of LspA conformational dynamics demonstrated that while crystallography captured only specific states, MD simulations revealed additional conformations . EPR data showed distance distributions supporting multiple conformations rather than a single state . This integrated approach resolved apparent contradictions by revealing that LspA samples all three conformational states (closed, intermediate, and open) with different populations under various conditions .

  • Dealing with Specific Contradictions: When faced with contradictory data points:

    • Assess technique-specific limitations and biases

    • Consider if differences represent actual conformational states or methodological artifacts

    • Evaluate if contradictions involve functionally relevant states or minor variations

    • Design experiments specifically targeted at resolving the contradiction

This balanced approach recognizes that apparent contradictions in membrane protein dynamics often represent different aspects of a complex conformational landscape rather than experimental errors.

What statistical approaches are most appropriate for analyzing strain-specific variations in D. nodosus LspA?

Analyzing strain-specific variations in D. nodosus LspA requires robust statistical approaches to distinguish meaningful biological variation from experimental noise:

  • Sequence-Based Analysis:

    • Multiple Sequence Alignment (MSA): Use MUSCLE or MAFFT algorithms optimized for protein sequences

    • Phylogenetic Analysis: Maximum likelihood or Bayesian methods to construct evolutionary relationships

    • Conservation Scoring: Position-specific scoring matrices to identify conserved vs. variable regions

    • Coevolution Analysis: Statistical coupling analysis (SCA) or direct coupling analysis (DCA) to identify co-evolving residues indicating functional relationships

  • Structure-Based Statistical Methods:

    • Root Mean Square Deviation (RMSD): Compare structural models of different strains

    • Principal Component Analysis (PCA): Identify major modes of structural variation

    • Normal Mode Analysis (NMA): Characterize intrinsic flexibility differences

    • Free Energy Calculations: Assess stability differences using statistical mechanics approaches

  • Functional Data Analysis:

    • Enzyme Kinetics Modeling: Nonlinear regression to determine kinetic parameters

    • ANOVA with Post-hoc Tests: Compare activity levels across multiple strains

    • Multivariate Analysis: Factor analysis to correlate sequence variations with functional differences

  • Population Genetics Approaches:

    • FST Statistics: Measure genetic differentiation between strains

    • Tajima's D Test: Detect selection pressures on specific regions of LspA

    • Linkage Disequilibrium Analysis: Identify co-inherited variations

  • Machine Learning Applications:

    • Random Forest Classification: Identify sequence features that distinguish strain groups

    • Support Vector Machines: Predict functional properties from sequence variations

    • Deep Learning Models: Extract complex patterns from large sequence datasets

Statistical ApproachApplicationAdvantagesLimitations
Phylogenetic AnalysisEvolutionary relationshipsPlaces variations in evolutionary contextAssumes uniform evolutionary rates
PCA of Structural ModelsMajor structural variationsReduces dimensionality of complex dataRequires accurate structural models
ANOVA of Activity DataFunctional differencesStraightforward statistical significanceMay miss complex interaction effects
FST AnalysisPopulation differentiationQuantifies genetic distance between strainsRequires defined population boundaries
Machine LearningPredictive modelingCan identify complex patternsRequires large training datasets

When analyzing novel D. nodosus strains like B(de1) and H(de1) , these statistical approaches can help characterize the functional significance of observed sequence variations and their potential impact on virulence and antibiotic susceptibility.

How can researchers distinguish between in vivo recombination and PCR artifacts when studying novel D. nodosus strains?

Distinguishing between genuine in vivo recombination events and PCR-generated artifacts is crucial for accurate characterization of novel D. nodosus strains. Previous research has encountered this exact challenge when investigating novel fimbrial subunit genes (fimA) of D. nodosus . Researchers should implement the following comprehensive approach:

  • Control Experiments:

    • Perform PCR using artificial mixtures of known template DNA (e.g., mix DNA from serotypes M and F1 or E1 and F1)

    • Compare amplification products from mixed templates with those from field samples

    • Include single-template controls alongside mixed-template reactions

  • PCR Protocol Optimization:

    • Use high-fidelity polymerases with proofreading activity

    • Minimize cycle numbers to reduce chimera formation

    • Optimize extension times to ensure complete synthesis

    • Employ touchdown PCR to increase specificity

  • Multiple Primer Strategies:

    • Design strain-specific primer sets targeting unique regions

    • Perform nested PCR with different primer combinations

    • Use primer sets that would only amplify recombinant templates

  • Advanced Molecular Verification:

    • Apply long-read sequencing technologies (PacBio, Nanopore) to capture entire genes without assembly

    • Use cloning and sequencing of multiple independent clones

    • Perform Southern blot analysis with strain-specific probes

  • Bioinformatic Analysis:

    • Check for recombination signatures (e.g., Chi-like sequences)

    • Analyze sequence homology patterns across different regions

    • Apply recombination detection algorithms (RDP, MaxChi, Bootscan)

    • Examine flanking sequences for evidence of legitimate recombination

  • Frequency Analysis:

    • Compare frequency of potential recombinants in initial vs. re-amplified samples

    • True recombinants should maintain consistent frequencies

    • PCR artifacts typically increase in frequency with additional amplification cycles

In a key study, researchers observed that when reactions containing mixed genomic DNA from different serotypes were re-amplified, PCR recombination artifacts appeared, while they were absent in the initial amplification . This indicated that PCR recombination occurs at low frequency during routine amplification. In contrast, novel fragments (X and Y) isolated directly from footrot samples were likely genuine fimA genes resulting from in vivo DNA recombination rather than PCR artifacts .

The presence of a 14-mer sequence consisting of two partially overlapping Chi-like sequences (5'-GCTGGTGCTGGTGA-3') in the novel fragments further supported the in vivo recombination hypothesis, as Chi sequences are known to be involved in recombination processes in bacteria .

What emerging technologies show promise for advancing D. nodosus LspA research?

Several cutting-edge technologies are poised to transform research on D. nodosus LspA:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of membrane proteins in near-native environments

    • Can capture multiple conformational states simultaneously

    • Recent advances allow for resolution approaching X-ray crystallography

    • Could reveal D. nodosus LspA structure without crystallization artifacts

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET):

    • Directly observes conformational dynamics at single-molecule resolution

    • Can track conformational changes in real-time

    • Would complement existing EPR studies on LspA dynamics

    • Could correlate conformational states with catalytic activity

  • Nanodiscs and Membrane Mimetics:

    • Improved nanodiscs with controlled lipid composition

    • Polymer-based membrane mimetics (SMALPs, amphipols)

    • Enable functional studies in native-like membrane environments

    • Preserve conformational dynamics better than detergent systems

  • CRISPR/Cas9 Genome Editing:

    • Generate precise mutations in D. nodosus LspA in vivo

    • Create reporter strains for high-throughput screening

    • Engineer strains expressing tagged LspA for in vivo tracking

    • Develop attenuated strains for vaccine development

  • Microfluidics and Organ-on-a-Chip:

    • Recreate microenvironments of infected hooves

    • Test LspA inhibitors under physiologically relevant conditions

    • Model biofilm formation and antibiotic penetration

    • High-throughput screening of drug candidates

  • Artificial Intelligence and Machine Learning:

    • Predict structural impacts of strain-specific variations

    • Design optimized inhibitors targeting conserved regions

    • Model the complex conformational landscape of LspA

    • Generate focused chemical libraries for screening

  • Integrative Structural Biology:

    • Combine data from multiple experimental techniques (X-ray, Cryo-EM, NMR, EPR)

    • Create comprehensive models of LspA dynamics across timescales

    • Better understand the entire conformational ensemble

    • Similar approaches have already revealed conformational states not observed in crystal structures alone

These technologies will enable researchers to address fundamental questions about D. nodosus LspA structure, function, and inhibition that remain challenging with current methodologies.

How might understanding LspA contribute to broader bacterial pathogenesis research?

Research on D. nodosus LspA has significant implications for understanding bacterial pathogenesis more broadly:

  • Conserved Virulence Mechanisms: LspA is part of the lipoprotein processing pathway that is essential in many pathogenic bacteria . Insights from D. nodosus LspA research can inform understanding of similar mechanisms in other pathogens, including human pathogens like Pseudomonas aeruginosa and Staphylococcus aureus.

  • Membrane Biology Principles: The conformational dynamics of LspA reveal fundamental principles about membrane protein function and regulation . These principles (such as how periplasmic helices control active site accessibility) may apply to other membrane enzymes involved in pathogenesis.

  • Antibiotic Resistance Mechanisms: Understanding how LspA's structural features contribute to its low propensity for resistance development may inform general strategies for designing antibiotics with higher barriers to resistance.

  • Bacterial Adaptation and Evolution: Studies of D. nodosus strain variation and recombination provide insights into how bacterial pathogens adapt to selective pressures, with potential parallels to other pathogens' evolutionary mechanisms.

  • Host-Pathogen Interactions: Proper lipoprotein processing by LspA affects multiple bacterial functions related to host interaction, including adhesion, stress sensing, and activation of host immune responses . These processes are fundamental to many bacterial infections.

  • Footrot as a Model Disease: As a well-characterized infection with a defined causative agent, footrot serves as a model system for studying polymicrobial infections and environmental factors in disease progression.

  • One Health Approach: Research bridging animal and human pathogens exemplifies the "One Health" concept, recognizing that human health, animal health, and environmental health are interconnected. Advances in understanding and treating D. nodosus infections may inform approaches to human bacterial pathogens using similar virulence mechanisms.

The mechanistic insights gained from studying D. nodosus LspA—particularly its conformational dynamics, substrate specificity, and inhibition mechanisms—contribute valuable knowledge to the broader field of bacterial pathogenesis research.

What collaborative research approaches would accelerate D. nodosus LspA inhibitor development?

Accelerating D. nodosus LspA inhibitor development requires strategic collaboration across multiple disciplines:

  • Academic-Industry Partnerships:

    • Combine academic expertise in D. nodosus biology with pharmaceutical industry drug development capabilities

    • Share resources like compound libraries, screening facilities, and animal models

    • Establish clear intellectual property frameworks to incentivize participation

  • Multi-Institutional Consortia:

    • Create focused research networks connecting veterinary, microbiological, and structural biology institutions

    • Distribute specialized technical work across centers of excellence

    • Implement standardized protocols to ensure comparable results across sites

  • Interdisciplinary Research Teams:

    • Integrate structural biologists, microbiologists, veterinarians, medicinal chemists, and computational scientists

    • Establish regular communication channels to bridge disciplinary language barriers

    • Develop shared research goals with discipline-specific milestones

  • Collaborative Technology Platforms:

    • High-throughput screening facilities accessible to multiple research groups

    • Shared computational resources for molecular modeling and simulation

    • Centralized database of LspA structural, functional, and inhibition data

    • Collaborative sample banks of D. nodosus clinical isolates

  • Translational Research Pipeline:

    • Coordinate sequential stages from target validation to preclinical testing

    • Establish clear criteria for advancing candidates through development stages

    • Create feedback loops between clinical observations and basic research

  • Open Science Initiatives:

    • Pre-competitive data sharing for basic LspA characteristics

    • Open-access publication of foundational research

    • Development of community resources (e.g., standardized assays, reference strains)

  • Targeted Funding Mechanisms:

    • Public-private partnerships focusing on agricultural antibiotic development

    • Research grants specifically supporting collaborative approaches

    • Milestone-based funding to incentivize progress toward clinical applications

A collaborative framework would address the major challenges in D. nodosus LspA inhibitor development by combining expertise across the research spectrum—from structural studies that have revealed the convergent inhibitory mechanism of antibiotics like globomycin and myxovirescin , to field testing in agricultural settings. The identification of the shared 19-atom motif between structurally distinct antibiotics provides a specific molecular template that could be the focus of such collaborative drug development efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.