Recombinant Dichelobacter nodosus Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Contextual Analysis of Na(+)-Translocating NADH-Quinone Reductase Subunit E

This enzyme subunit (commonly abbreviated as NqrE) is a critical component of the bacterial Na(+)-NQR complex, a respiratory sodium pump that couples NADH oxidation with quinone reduction to generate a sodium motive force. While extensively studied in Vibrio species (V. cholerae, V. fischeri) and Pseudoalteromonas atlantica , no peer-reviewed studies or commercial protein entries explicitly mention its recombinant expression or characterization in Dichelobacter nodosus.

Na(+)-NQR Subunit E in Other Bacteria

OrganismSubunit E FeaturesReference
Vibrio choleraeEncoded by nqrE gene; membrane-bound subunit with Fe-S centers for electron transfer
Vibrio fischeriRecombinant His-tagged NqrE (1-198aa) expressed in E. coli; used for structural studies
Pseudoalteromonas atlanticaRecombinant NqrE (1-202aa) with N-terminal His tag; similar topology to Vibrio homologs

Dichelobacter nodosus Respiratory Enzymes

  • The genome of D. nodosus JKS-07B encodes RnfB, a component of an Rnf-like electron transport complex, but no homologs of Na(+)-NQR subunits were identified in available annotations .

  • Primary respiratory enzymes in D. nodosus focus on protease production (e.g., AprV2, AprB5) rather than sodium-pumping NADH dehydrogenases .

Potential Explanations for Data Absence

  1. Biological Relevance: Dichelobacter nodosus, a pathogen causing ovine footrot, primarily relies on fermentative metabolism and protease secretion for virulence. Sodium-dependent respiration may not be central to its physiology .

  2. Research Gaps: No studies have reported cloning, expression, or functional characterization of Na(+)-NQR subunits in this organism.

Recommendations for Future Research

To investigate Recombinant Dichelobacter nodosus NqrE:

  1. Genomic Mining: Verify the presence of nqrE homologs in D. nodosus genomes using tools like BLAST or InterPro (IPR008703, IPR022615).

  2. Heterologous Expression: Clone putative nqrE genes into E. coli or Vibrio expression systems (e.g., pET or pBAD vectors) and purify via His-tag affinity chromatography .

  3. Functional Assays: Test NADH:quinone oxidoreductase activity in the presence of Na+ ions and compare kinetics to Vibrio NqrE .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; DNO_0807; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Dichelobacter nodosus (strain VCS1703A)
Target Names
nqrE
Target Protein Sequence
MEHYLSLLIKSIFIENMALSFFLGMCTFLAVSKKISTAIGLGTAVIVVQTLTVPLNNLLY VYLLKDNAILWQHLGVNVDISFLGLIAYIGVIAAVVQILEMFLDKYVPALYSALGIFLPL ITVNCAILAGSLFMVERNYTFQESMVYGVGSGVGWALAIAVMAGVREKMRYADVPKGLEG LGITFITAGLMAIGFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol via two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Na(+)-translocating NADH-quinone reductase (NQR) in Dichelobacter nodosus?

Na(+)-translocating NADH:quinone oxidoreductase (NQR) is a membrane-bound respiratory enzyme complex that serves as the main producer of sodium motive force (SMF) in D. nodosus. The complex catalyzes electron transfer from NADH to ubiquinone, coupled with Na+ translocation across the bacterial membrane . This process drives crucial energy-dissipating cellular functions including:

  • Flagellar rotation

  • Substrate uptake

  • ATP synthesis

  • Cation-proton antiport

In the respiratory chain of pathogenic bacteria like D. nodosus, NQR plays a central role in energy metabolism by converting the energy from NADH oxidation into an electrochemical sodium gradient. This gradient is subsequently used by the bacterial cell for various energy-requiring processes, making the enzyme essential for bacterial viability .

How can researchers successfully express and purify recombinant D. nodosus NqrE protein?

Successful expression and purification of recombinant D. nodosus NqrE requires specific methodological considerations due to the transmembrane nature of the protein:

Expression System Selection:

  • E. coli BL21(DE3) strain is recommended using pET expression vectors (pET32a) for thioredoxin-tagged fusion proteins

  • Cell-free expression systems may be beneficial for transmembrane proteins with toxicity issues

Expression Protocol:

  • Transform the expression construct into E. coli BL21(DE3)

  • Culture in LB medium supplemented with 1% glucose to reduce toxicity to host cells

  • Induce expression with IPTG (0.1-0.5 mM) when OD600 reaches 0.6-0.8

  • Continue incubation at lower temperature (16-25°C) for 16-20 hours to improve protein folding

  • Harvest cells by centrifugation at 5,000 × g for 10 minutes

Purification Strategy:

  • Resuspend cell pellet in lysis buffer containing appropriate detergents (e.g., SDS or mild non-ionic detergents)

  • Disrupt cells via sonication or mechanical methods

  • Clarify lysate by centrifugation at 12,000 × g for 20 minutes

  • Purify using Ni-NTA affinity chromatography under native conditions for His-tagged proteins

  • Elute with increasing concentrations of imidazole (250-500 mM)

  • Analyze purity by SDS-PAGE and confirm identity by Western blotting using anti-His antibodies

Important Considerations:

  • The addition of 1% glucose to growth media is crucial as recombinant NqrE can be toxic to host cells

  • Repeated freeze-thaw cycles of cell lysate can increase protein yield

  • For optimal results, purification should be performed at 4°C to minimize protein degradation

  • Buffer composition should include stabilizers such as glycerol (20-50%) for long-term storage

What challenges might researchers face when working with recombinant D. nodosus NqrE, and how can these be overcome?

Working with recombinant D. nodosus NqrE presents several technical challenges that researchers should anticipate:

Challenge 1: Host Toxicity

  • Evidence: Transformed BL21 cells show poor growth on LB/ampicillin agar without glucose supplementation

  • Solution: Add 1% glucose to growth media to suppress basal expression and reduce toxicity

Challenge 2: Low Expression Yields

  • Evidence: Decline in turbidity of induced cultures compared to uninduced controls

  • Solutions:

    • Use C41(DE3) or C43(DE3) E. coli strains specifically designed for toxic membrane proteins

    • Optimize induction conditions (lower IPTG concentration, lower temperature)

    • Consider codon optimization for E. coli expression

Challenge 3: Protein Solubility and Extraction

  • Evidence: NqrE proteins do not assemble into mature structures in E. coli and require detergents for extraction

  • Solutions:

    • Use appropriate detergents (SDS, DDM, or LDAO) for membrane protein solubilization

    • Incorporate freeze-thaw cycles to increase protein release from cellular membranes

    • Extend incubation time post-induction to improve yields

Challenge 4: Maintaining Native Conformation

  • Evidence: Membrane proteins often lose native structure during purification

  • Solutions:

    • Use milder detergents for purification steps

    • Include stabilizing agents (glycerol, specific lipids) in purification buffers

    • Consider nanodiscs or liposomes for reconstitution of purified protein

Challenge 5: Storage Stability

  • Solutions:

    • Store in buffer containing 20-50% glycerol at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles of purified protein

    • Aliquot protein samples before freezing

How does the NQR complex contribute to iron homeostasis in bacterial pathogens, and what implications does this have for D. nodosus virulence?

The NQR complex has been shown to significantly impact iron homeostasis in bacterial pathogens, with potential implications for D. nodosus virulence:

NQR's Connection to Iron Metabolism:

  • In Vibrio cholerae, deletion of the NQR complex (Δnqr) results in upregulation of iron transport systems, particularly the ferrous iron transporter FeoB (2.7-fold increase)

  • NQR mutants show improved growth rates with Fe2+ as an iron source

  • The nqr operon is induced by iron in wild-type bacteria, suggesting a regulatory feedback mechanism

Molecular Mechanisms:

  • The NQR complex contains Fe-S clusters as essential cofactors

  • In NQR-deficient mutants, the bacterial response includes upregulation of iron acquisition systems to compensate for metabolic changes

  • The membrane-bound subunits NqrD and NqrE ligate an Fe center within the membrane part of the complex

Implications for D. nodosus Virulence:

  • Iron acquisition is critical for bacterial pathogens in iron-limited host environments

  • Alteration of NQR function may affect energy metabolism and iron homeostasis simultaneously

  • This dual role makes NQR a potential drug target for antibiotics against D. nodosus infections

The table below summarizes the differential regulation of iron transport proteins observed in NQR deletion mutants compared to wild-type bacteria:

Protein IDGeneProtein DescriptionRelative Change in Δnqr
A0A0H3AKG5fhuCFe3+-ferrichrome ABC transporter+4.1
A0A0H3AFY3feoBFe2+ transport protein+2.7
A0A0H3AJZ5fbpAFe3+ periplasmic binding protein-2.1
A5F661viuAFe3+-vibriobactin outer membrane transporterNo change
A0A0H3AHM4viuPFe3+-vibriobactin binding proteinNo change

Table based on proteome analysis data from V. cholerae wild-type vs. Δnqr strains

Understanding these interactions may facilitate the development of novel approaches to control D. nodosus infections in sheep.

What methodologies are most effective for investigating NqrE function in the context of footrot pathogenesis?

To effectively investigate NqrE function in D. nodosus footrot pathogenesis, researchers should consider a multi-faceted approach combining various methodological strategies:

Genetic Manipulation Techniques:

  • Gene Deletion/Knockout

    • Create precise nqrE deletion mutants using allelic exchange methods

    • Assess growth characteristics and virulence phenotypes in comparison to wild-type strains

  • Complementation Studies

    • Introduce functional nqrE gene in trans to confirm phenotype specificity

    • Use inducible expression systems to control NqrE levels

  • Site-Directed Mutagenesis

    • Target conserved amino acid residues predicted to be involved in Na+ binding or electron transport

    • Create point mutations to identify critical functional domains

Molecular and Biochemical Approaches:

  • Protein-Protein Interaction Studies

    • Co-immunoprecipitation to identify interaction partners within the NQR complex

    • Bacterial two-hybrid systems to validate protein interactions

  • Electron Transport Measurements

    • Assess NADH oxidation rates and ubiquinone reduction in isolated membranes

    • Measure Na+ transport using fluorescent dyes or radioactive Na+ isotopes

Virulence Assessment Methods:

  • In Vitro Models

    • Evaluate proteolytic activity using gelatin gel tests, which correlate with virulence

    • Assess biofilm formation and adhesion to keratinocytes or hoof tissue explants

  • Multiple Locus Variable Number Tandem Repeat Analysis (MLVA)

    • Implement the optimized MLVA protocol as described by Muzafar et al. for strain typing

    • Use this approach to track specific NqrE variants in disease outbreaks

MLVA primers for D. nodosus strain typing:

DNTR LocusForward Primer (5'-3')Reverse Primer (5'-3')Expected Size Range (bp)
DNTR02CTGCACACGCAACGTTTACAGGCGAACGCCTACTGTATCAVariable
DNTR09GAAGTTTGTGAGGCTATCCGATAGCGTTTGTTTCGAGVariable
DNTR10GATCCATCAATCTTTCTCCGCACTTTAGGATTATTAVariable
DNTR19GCACTAACGTTTGCTGCCGGTATCAAGGCAGCTACGVariable

Table adapted from PCR conditions for MLVA of D. nodosus

Comparative Genomics Approaches:

  • Analyze nqrE sequence variation across D. nodosus strains with different virulence profiles

  • Examine co-evolution of nqrE with other virulence factors such as fimA (fimbrial subunit gene)

By integrating these methodologies, researchers can comprehensively evaluate the role of NqrE in D. nodosus physiology and its contribution to footrot pathogenesis.

How does the NqrE subunit of D. nodosus compare structurally and functionally with homologous proteins in other bacterial species?

Comparative analysis of the NqrE subunit across different bacterial species reveals important structural and functional conservation patterns, as well as species-specific adaptations:

Sequence Homology Analysis:

When comparing the amino acid sequences of NqrE from D. nodosus with other bacterial species, we observe:

  • High conservation in transmembrane domains and Na+ binding motifs

  • Greater sequence divergence in loop regions connecting transmembrane segments

  • Conservation of key functional residues involved in electron transport

Amino Acid Sequence Comparison:

Bacterial SpeciesSequence Length (aa)Identity with D. nodosus NqrE (%)Notable Structural Features
D. nodosus (VCS1703A)203100Benchmark sequence
Pseudoalteromonas atlantica202~65Similar hydrophobicity profile
Vibrio cholerae198~55Additional lipid interaction sites
Neisseria meningitidis200~50Modified N-terminus region

Functional Comparisons:

The NQR complex across different bacterial species shows conserved core functions but with species-specific adaptations:

  • Common Functions:

    • NADH oxidation coupled to Na+ translocation

    • Generation of sodium motive force (SMF)

    • Role in respiration and energy metabolism

  • Species-Specific Adaptations:

    • V. cholerae NQR: Integration with iron homeostasis pathways

    • P. atlantica NQR: Adapted for marine environment with higher Na+ concentrations

    • D. nodosus NQR: Potential adaptation to the anaerobic environment of hoof infections

Evolutionary Implications:

Phylogenetic analysis suggests that:

  • The NQR complex likely evolved from ancestral redox enzyme systems

  • NqrE exhibits signs of purifying selection with dN/dS ratios typically <1, indicating stabilizing selective pressure

  • The nqr operon organization (including nqrE) is highly conserved across species, suggesting functional constraints

Understanding these structural and functional relationships can inform research into potential antibiotic targets that could selectively inhibit D. nodosus NqrE while minimizing effects on commensal bacteria.

What insights can genomic analysis of D. nodosus provide about the evolution and adaptation of the NQR complex?

Genomic analysis of D. nodosus provides several important insights regarding the evolution and adaptation of the NQR complex:

Genomic Context and Operon Structure:

The complete genome sequencing of D. nodosus strains has revealed that:

  • The nqr genes in D. nodosus are organized in an operon structure (nqrABCDEF)

  • Additional genes involved in NQR assembly and function (apbE and nqrM) are located downstream of the structural genes

  • The operon structure is conserved across different D. nodosus strains, suggesting functional constraints

Comparative Genomics Findings:

Analysis of the D. nodosus JKS-07B genome (1,311,533 bp, GC content 44.38%) and comparison with other strains reveals:

  • High sequence conservation of NQR complex genes (98.63% sequence homology with reference genome VCS1703A)

  • Specific SNPs and InDels that may influence NQR function in different strains

  • Evidence of lateral gene transfer in the D. nodosus genome, which may have influenced NQR evolution

Evolutionary Adaptation Signals:

Several evolutionary signatures are observed in the NQR complex:

  • Selective Pressure Analysis:

    • Evidence of purifying selection on nqr genes suggests functional importance

    • Conservation of key catalytic and structural residues across strains

  • Strain Variation and Virulence:

    • Correlation between specific NQR variants and virulence profiles

    • Potential co-evolution with other virulence determinants such as fimA (fimbrial subunit gene)

  • Host-Pathogen Co-evolution:

    • Adaptation of the NQR complex to the anaerobic environment of sheep hooves

    • Possible selection for optimal function in the unique niche of hoof infections

  • Metabolic Integration:

    • Evolution of regulatory mechanisms linking NQR function to iron acquisition systems

    • Development of specialized energy metabolism suited to the footrot infection environment

These genomic insights suggest that the NQR complex represents an evolutionarily conserved, yet adaptable machinery that contributes to D. nodosus survival and pathogenicity. The relatively small genome size of D. nodosus (approximately 1.3 Mb) and the retention of the complete NQR system emphasizes the essential nature of this enzyme complex for the bacterium's survival and pathogenicity.

How might recombinant D. nodosus NqrE be utilized for vaccine development against footrot?

Recombinant D. nodosus NqrE presents a novel target for vaccine development against footrot, with several strategic approaches that merit investigation:

Rationale for NqrE as a Vaccine Target:

  • Surface exposure of portions of the NqrE protein in the bacterial membrane

  • Essential role in energy metabolism making functional escape mutations less likely

  • Relative conservation across D. nodosus strains compared to more variable surface antigens

  • Connection to iron homeostasis, a pathway critical for in vivo survival

Potential Vaccine Strategies:

  • Subunit Vaccine Approach:

    • Use purified recombinant NqrE (full-length or immunogenic fragments)

    • Combine with appropriate adjuvants to enhance immunogenicity

    • Methodological considerations:

      • Express in E. coli using optimized protocols to ensure proper folding

      • Consider fusion partners (thioredoxin, MBP) to improve stability and immunogenicity

      • Purification under conditions that preserve immunogenic epitopes

  • Multi-antigen Combinatorial Approach:

    • Combine NqrE with established immunogens like fimbrial proteins (FimA)

    • Target multiple virulence factors simultaneously to prevent escape

    • Current research indicates that FimA-based vaccines provide serogroup-specific protection

  • Epitope-based Design:

    • Identify and synthesize conserved, immunogenic epitopes from NqrE

    • Create chimeric constructs with multiple epitopes from different virulence factors

    • Advantages include improved safety profile and targeted immune response

Experimental Evaluation Protocol:

  • Immunogenicity Assessment:

    • Animal immunization with various NqrE-based formulations

    • Measure antibody titers using ELISA and functional assays

    • Assess cellular immune responses via lymphocyte proliferation assays

  • Protection Studies:

    • Challenge model using virulent D. nodosus strains

    • Score foot lesions using established clinical scoring systems

    • Evaluate bacterial clearance through direct detection methods

  • Cross-protection Analysis:

    • Test vaccine efficacy against multiple D. nodosus serogroups

    • Combine with typing data from MLVA studies to ensure broad coverage

Challenges and Considerations:

  • Potential toxicity of recombinant NqrE for host cells may require modification strategies

  • Proper folding of membrane protein antigens is critical for eliciting protective antibodies

  • Combination with existing vaccine approaches may be necessary for optimal protection

  • Field trials would need to account for environmental factors influencing footrot persistence

This approach represents a departure from traditional footrot vaccine strategies that have focused primarily on fimbrial antigens, potentially offering broader protection across D. nodosus serogroups.

What potential exists for inhibiting NqrE function as a novel antimicrobial strategy against D. nodosus infections?

The critical role of NqrE in D. nodosus energy metabolism makes it an attractive target for novel antimicrobial development with several strategic advantages:

Theoretical Basis for NqrE Inhibition:

  • Metabolic Vulnerability:

    • NQR complex is essential for respiratory energy generation

    • Inhibition would disrupt Na+ gradient and subsequent ATP production

    • Bacterial growth would be compromised even under sublethal inhibition

  • Linked Pathways Effect:

    • NQR's connection to iron homeostasis means inhibitors may disrupt multiple essential pathways simultaneously

    • The inhibition may create synergistic vulnerability to host immune defenses

  • Structural Uniqueness:

    • NQR's structure differs significantly from mammalian respiratory complexes

    • Bacterial Na+-dependent respiration represents a specific target absent in host cells

Inhibitor Development Strategies:

  • Structure-Based Drug Design:

    • Develop atomic models of D. nodosus NqrE using homology modeling

    • Identify potential binding pockets through in silico analysis

    • Perform virtual screening of compound libraries against predicted binding sites

  • High-Throughput Screening:

    • Develop assays measuring NQR activity (NADH oxidation, Na+ transport)

    • Screen chemical libraries for compounds inhibiting these functions

    • Optimize lead compounds for improved potency and selectivity

  • Peptide-Based Inhibitors:

    • Design peptides that mimic critical interaction surfaces of NqrE

    • Target protein-protein interactions within the NQR complex

    • Conjugate with cell-penetrating peptides to improve cellular delivery

Evaluation and Validation Approaches:

  • In Vitro Assessment:

    • Measure inhibition of recombinant NqrE function

    • Assess impact on bacterial growth and survival

    • Determine minimum inhibitory concentrations (MICs)

  • Specificity Testing:

    • Evaluate effects on mammalian cell viability

    • Test against other bacterial species to determine spectrum of activity

    • Assess potential for resistance development

  • In Vivo Testing:

    • Evaluate efficacy in animal models of footrot

    • Determine tissue distribution and pharmacokinetics

    • Assess potential for topical application in hoof treatments

Challenges and Considerations:

  • Transmembrane nature of NqrE presents challenges for inhibitor design and delivery

  • Need for highly specific inhibitors to avoid disruption of host cellular processes

  • Potential for development of resistance through mutations in NqrE

  • Formulation challenges for application in the unique environment of hoof infections

This antimicrobial approach would represent a novel mechanism of action distinct from current antibiotics used in footrot treatment, potentially addressing issues of antimicrobial resistance in veterinary medicine.

How are advanced molecular techniques being applied to understand the strain variation in D. nodosus NqrE and its impact on virulence?

Current research is employing sophisticated molecular techniques to characterize strain variations in D. nodosus NqrE and elucidate their impact on virulence:

Genomic Approaches:

  • Whole Genome Sequencing and Comparative Genomics:

    • Complete genomes of multiple D. nodosus isolates have been sequenced (e.g., JKS-07B strain)

    • Comparative analysis has identified SNPs and InDels in nqrE and related genes

    • These variations are being correlated with virulence phenotypes

  • Multilocus Sequence Typing (MLST) and MLVA:

    • Enhanced MLVA protocols have been optimized for D. nodosus strain typing

    • These approaches allow tracking of specific strains in outbreaks

    • The PubMLST database for D. nodosus contains 171 isolates with 115 sequence types, showing high genetic diversity

Functional Genomics Methods:

  • Transcriptomics:

    • RNA-Seq analysis of D. nodosus under different environmental conditions

    • Quantitative RT-PCR studies have demonstrated differential expression of nqr operons in response to iron availability

    • Expression patterns are being linked to virulence-associated phenotypes

  • Proteomics:

    • Comparative proteome analysis between wild-type and mutant strains

    • Identification of protein interaction networks involving NqrE

    • Post-translational modifications affecting NqrE function

Structure-Function Analysis:

  • Site-Directed Mutagenesis:

    • Targeted modification of conserved residues in NqrE

    • Assessment of functional impact on Na+ transport and respiratory activity

    • Correlation of specific amino acid variations with virulence profiles

  • Protein Modeling and Simulation:

    • Computational prediction of NqrE structure based on homology modeling

    • Molecular dynamics simulations to understand conformational dynamics

    • Prediction of strain-specific structural alterations

Virulence Correlation Studies:

Recent research has established methods to differentiate virulent from benign strains:

  • Proteolytic enzyme profiles (gelatin gel test)

  • PCR detection of specific virulence markers like aprV2/aprB2 and intA genes

  • These approaches are being integrated with NqrE variation data to establish potential correlations

The table below summarizes key molecular markers used for virulence assessment in D. nodosus:

Virulence MarkerDetection MethodSignificanceReference
aprV2 geneqPCREncodes thermostable protease in virulent strains
intA genePCRIntegrase gene associated with virulence
Thermostable proteasesGelatin gel testDirectly measures proteolytic activity
fimA variationsPCR/SequencingFimbrial antigen variations linked to virulence
NQR complex variantsGenomic/proteomic analysisEnergy metabolism differences potentially affecting virulence

These advanced molecular approaches are providing unprecedented insights into the relationship between NqrE variation and D. nodosus virulence, with important implications for diagnostic, therapeutic, and preventive strategies.

What are the current challenges in producing functional recombinant NqrE for structural studies, and how might these be overcome?

The production of functional recombinant NqrE for structural studies presents significant challenges that current research is addressing through innovative approaches:

Current Technical Challenges:

  • Membrane Protein Expression Barriers:

    • Toxicity to expression hosts as documented in E. coli BL21(DE3)

    • Improper folding in heterologous expression systems

    • Aggregation and inclusion body formation

    • Poor yields of properly folded, functional protein

  • Structural Characterization Difficulties:

    • Inherent flexibility of membrane proteins

    • Challenges in obtaining diffraction-quality crystals

    • Limited success with traditional structural biology methods

  • Functional Reconstitution Issues:

    • Lack of proper assembly into mature structures in recombinant systems

    • Need for detergent extraction that can compromise native structure

    • Difficulty maintaining Na+ transport activity in purified preparations

Innovative Solutions and Emerging Approaches:

  • Alternative Expression Systems:

    • Cell-free protein synthesis systems optimized for membrane proteins

    • Specialized E. coli strains (C41/C43) engineered for toxic membrane proteins

    • Insect cell or mammalian expression systems for complex membrane proteins

  • Fusion Partners and Engineering:

    • Novel fusion constructs beyond traditional thioredoxin tags

    • Truncation strategies targeting soluble domains for initial structural studies

    • Chimeric constructs with well-characterized membrane proteins

  • Advanced Stabilization Techniques:

    • Systematic detergent screening using high-throughput approaches

    • Nanodiscs or lipid cubic phase technologies for membrane protein stabilization

    • Conformation-specific nanobodies to stabilize specific protein conformations

  • Cutting-Edge Structural Methods:

    • Cryo-electron microscopy (cryo-EM) for membrane protein structure determination

    • Solid-state NMR approaches for membrane protein analysis

    • Integrated structural biology combining multiple complementary techniques

Optimization Strategies for Research Applications:

  • Expression Protocol Refinements:

    • Precise control of expression rates through tunable promoter systems

    • Co-expression with chaperones and assembly factors

    • Optimal induction conditions (temperature, time, inducer concentration)

  • Purification Improvements:

    • Gentle solubilization using novel detergents or styrene maleic acid copolymer (SMA) approach

    • Affinity tag placement optimization to minimize interference with function

    • On-column refolding protocols for recovered proteins from inclusion bodies

  • Functional Validation Approaches:

    • Development of sensitive assays for Na+ transport function

    • Reconstitution into proteoliposomes for activity measurements

    • Spectroscopic methods to monitor cofactor incorporation and electron transfer

The implementation of these strategies represents the frontier of research on membrane proteins like NqrE, with each technological advance bringing structural and functional studies closer to feasibility. Success in these approaches would provide unprecedented insights into the structure-function relationship of NqrE and enable rational design of inhibitors or vaccines targeting this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.