Recombinant Dichelobacter nodosus Type 4 prepilin-like proteins leader peptide-processing enzyme (fimP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
fimP; Prepilin leader peptidase/N-methyltransferase [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Dichelobacter nodosus (Bacteroides nodosus)
Target Names
fimP
Target Protein Sequence
MLISELLQTPLGIFFVGLFSLMVGSFLNVVIYRVPVMMDREEKQYAWQVFHGEDSVCPEI PKQRFNLLVPASRCPHCGHRIRAIENIPVISWLFLKGKCSGCGAAISARYLLVELLTAAL SVIVAFHYHDPLSLGFALVFTWTLIALCFIDAEHQLLPDRLTLPLLWLGILAALFNVFIN LESSVIGAMIGYLSLWSVYWLFKLITGREGMGYGDFKLLACLCAWQGAWMLPIILFSAAI LGMIYALGIGLRMGKPMPFGPFLAIAGWLTFLYGAQIGQLFGYFPA
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in the formation of type IV pili and type II pseudopili. It proteolytically removes the leader sequence from substrate proteins, subsequently monomethylating the alpha-amino group of the newly exposed N-terminal phenylalanine.
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fimP enzyme and what role does it play in Dichelobacter nodosus?

The fimP enzyme in Dichelobacter nodosus is a type 4 prepilin peptidase that plays a crucial role in the processing of fimbrial subunits. It functions by cleaving the leader sequence from the FimA fimbrial subunit, which is an essential step in fimbrial biogenesis. FimP belongs to a novel family of bilobed aspartate proteases that is unlike any other protease class previously identified .

The enzyme is functionally equivalent to the PilD prepilin peptidase from Pseudomonas aeruginosa, as demonstrated by complementation studies where fimP can restore the ability of a P. aeruginosa pilD mutant to produce type IV fimbriae . In addition to its peptidase activity, FimP likely also possesses N-methyltransferase activity, which is crucial for proper fimbrial assembly, similar to what has been observed with PilD in P. aeruginosa .

How is the fimP gene organized within the D. nodosus genome?

The fimP gene in D. nodosus is organized as part of an operon structure along with several other genes involved in fimbrial biogenesis. Specifically, the genes ORFM, fimN, fimO, fimP, and ORF197 appear to be arranged in an operon, as demonstrated by transcriptional coupling experiments using RT-PCR .

Most of these open reading frames in this gene region overlap with each other, with the exception of fimN and fimO genes, which are separated by 19 base pairs. This genomic organization suggests coordinated expression of these genes, which is consistent with their related functions in fimbrial biogenesis . The operon structure allows for efficient co-regulation of these functionally related genes, ensuring they are expressed together when needed for fimbrial assembly.

What are the conserved structural features of fimP as a type 4 prepilin peptidase?

As a type 4 prepilin peptidase (TFPP), fimP belongs to a novel family of bilobed aspartate proteases with distinct structural features. The hallmark of this enzyme family is the presence of two conserved aspartic acid residues that form the active site of the enzyme. While the specific positions of these aspartic acids in fimP are not directly mentioned in the available data, they can be inferred from homologous enzymes .

For example, in Vibrio cholerae, the active site pairs of aspartic acids are found at positions 125 and 189 of TcpJ and 147 and 212 of VcpD . These conserved aspartate residues are critical for the catalytic function of the enzyme and are present throughout the entire TFPP family. The enzyme is likely membrane-bound, as is typical for type 4 prepilin peptidases, facilitating its interaction with prepilin substrates during their secretion process.

How does fimP compare functionally with other type 4 prepilin peptidases?

FimP from D. nodosus is functionally similar to other type 4 prepilin peptidases, particularly PilD from P. aeruginosa. Experimental evidence shows that the fimP gene can complement a pilD mutant of P. aeruginosa, restoring its ability to produce type IV fimbriae . This cross-species complementation demonstrates functional equivalence between these enzymes despite their evolutionary distance.

Like other type 4 prepilin peptidases, fimP likely has dual enzymatic activities:

  • Prepilin peptidase activity - cleaving the leader peptide from prepilin proteins

  • N-methyltransferase activity - methylating the newly exposed N-terminus after leader peptide cleavage

This dual functionality is critical because studies with PilD mutants of P. aeruginosa with reduced N-methyltransferase activity but normal peptidase activity cannot assemble intact pili, suggesting that methylation is required for proper fimbrial biogenesis . This functional conservation across bacterial species highlights the evolutionary importance of these enzymes in bacterial secretion systems.

What expression systems are most effective for producing recombinant fimP?

Based on research with related proteins, E. coli expression systems are commonly used for recombinant production of D. nodosus proteins, though they present specific challenges. When working with fimbrial proteins from D. nodosus, researchers have observed toxicity issues in E. coli host cells, particularly when using expression systems such as E. coli BL21(DE3) with pET vector systems .

Key considerations for expression include:

  • Toxicity management: Addition of 1% glucose to the media has been shown to be necessary for stable transformation and growth of E. coli harboring D. nodosus fimbrial proteins . This likely suppresses basal expression from the T7 promoter.

  • Expression induction: IPTG induction often leads to decreased cell viability and division, with marked decline in culture turbidity compared to uninduced controls . This suggests that controlled, lower-level expression may be preferable.

  • Protein localization: Recombinant fimbrial proteins from D. nodosus expressed in E. coli remain embedded in the bacterial cell envelope (primarily in the inner membrane) and do not assemble into mature fimbriae . Therefore, extraction requires detergent treatment (such as SDS).

Alternative expression systems that might be considered include P. aeruginosa-based systems, given the functional similarity between fimP and pilD, particularly for functional studies rather than high-yield protein production.

What are the most reliable methods for purifying active recombinant fimP?

Purification of recombinant fimP requires specific strategies due to its membrane-associated nature. Based on approaches used for similar proteins:

  • Affinity tagging strategy: Fusion with thioredoxin and polyhistidine tags (as used in pET32a vector systems) allows for efficient purification using Ni-NTA affinity chromatography . This approach has been successfully used for D. nodosus fimbrial proteins.

  • Extraction conditions: Since the recombinant protein is likely to be membrane-embedded, effective extraction requires detergent solubilization. SDS has been shown to be necessary for releasing D. nodosus fimbrial proteins from E. coli host cells .

  • Purification optimization:

    • Increasing incubation time post-induction of expression improves yield

    • Repeated freeze-thawing of cell lysate increases the release of recombinant protein

    • The second and third elution fractions from Ni-NTA chromatography typically contain the highest purity of target protein

  • Protein verification: Western blotting using Ni-NTA conjugate antibodies directed against polyhistidine-tagged recombinant protein can confirm the identity of the purified product .

How can researchers verify the enzymatic activity of purified recombinant fimP?

Verifying the enzymatic activity of purified recombinant fimP can be accomplished through several complementary approaches:

  • Complementation assays: The gold standard for functional verification is a complementation assay using a P. aeruginosa pilD mutant (such as PAKDΩ). Introduction of functional fimP should restore fimbrial production, which can be confirmed by electron microscopy . This approach directly demonstrates both the peptidase and putative N-methyltransferase activities of fimP.

  • In vitro cleavage assays: Using synthetic or recombinant prepilin substrates (such as pre-FimA) and measuring the cleavage of the leader peptide through:

    • SDS-PAGE analysis showing mobility shift after processing

    • Mass spectrometry confirmation of the precise cleavage site

    • N-terminal sequencing to verify removal of the leader peptide

  • Methyltransferase activity assay: Since fimP likely has N-methyltransferase activity (based on homology to PilD), researchers can measure the incorporation of methyl groups from S-adenosyl methionine (SAM) to the processed pilin substrate.

  • Inhibition studies: Comparing the effects of known aspartyl protease inhibitors on the activity can provide further confirmation of the enzymatic mechanism.

How does fimP contribute to the dual function of fimbrial biogenesis and protease secretion in D. nodosus?

D. nodosus fimP plays a complex dual role in both fimbrial biogenesis and extracellular protease secretion, representing a fascinating example of functional convergence in a small bacterial genome. This dual functionality has important implications for bacterial pathogenesis:

  • Fimbrial biogenesis role: FimP, alongside FimN, FimO, and PilE, is essential for type IV fimbrial biogenesis in D. nodosus. These fimbriae are critical virulence factors that facilitate attachment to host tissues and are required for twitching motility and natural transformation .

  • Protease secretion role: Research has demonstrated that mutations in fimP (as well as fimN, fimO, and pilE) significantly reduce the secretion of extracellular proteases in D. nodosus. This represents the first demonstration that PilB, PilC, and PilE homologs (and by extension, fimP) are required for the secretion of unrelated extracellular proteins in a type IV fimbriate bacterium .

  • Mechanism of dual function: The effect on protease secretion is not mediated at the transcriptional level, as confirmed by quantitative real-time PCR analysis of the three extracellular protease genes aprV2, aprV5, and bprV . This suggests a direct role in the secretion machinery.

  • Evolutionary significance: Bioinformatic analysis failed to identify a classical type II secretion system in D. nodosus, and the putative fimbrial biogenesis gene pilQ was the only outer membrane secretin gene identified. This suggests that in D. nodosus, protease secretion occurs by a type II secretion-related process that directly involves components of the type IV fimbrial biogenesis machinery, representing the only type II secretion system encoded by this highly specialized pathogen's small genome .

This dual functionality represents an elegant evolutionary adaptation that allows D. nodosus to efficiently utilize a single system for two critical aspects of its pathogenesis.

What are the key structural determinants of fimP substrate specificity?

While the specific structural determinants of fimP substrate specificity are not directly addressed in the provided search results, we can infer key aspects based on knowledge of related type 4 prepilin peptidases:

  • Active site architecture: As a member of the type 4 prepilin peptidase family, fimP likely contains two conserved aspartic acid residues that form the catalytic site . These residues are critical for substrate recognition and catalysis.

  • Substrate recognition elements: Type 4 prepilin peptidases recognize specific features in their prepilin substrates:

    • A characteristic N-terminal leader sequence

    • A conserved processing site (typically Gly-Phe)

    • A hydrophobic stretch following the cleavage site

  • Cross-species complementation insights: The ability of fimP to complement a P. aeruginosa pilD mutant indicates that fimP recognizes similar substrate features in the P. aeruginosa PilA prepilin . This suggests conservation in the substrate recognition mechanisms despite evolutionary distance between the bacterial species.

  • Membrane association: The membrane localization of fimP likely plays an important role in substrate specificity, positioning the enzyme to interact with prepilin substrates as they are being translocated across the membrane.

Further structural studies, including crystallography of fimP in complex with substrate analogs, would be necessary to fully elucidate the molecular basis of substrate recognition and specificity.

What is the relationship between fimP activity and D. nodosus virulence?

The relationship between fimP activity and D. nodosus virulence is multifaceted, stemming from its dual role in fimbrial biogenesis and protease secretion:

  • Fimbriae as virulence factors: Type IV fimbriae are major virulence factors and protective antigens in D. nodosus infections. They are essential for bacterial attachment to host tissues and contribute to twitching motility, which allows the bacterium to spread within host tissues . As a key enzyme in fimbrial biogenesis, fimP activity directly impacts the production of these important virulence structures.

  • Protease secretion connection: D. nodosus secretes extracellular proteases that are critical virulence factors involved in tissue degradation during footrot infection. These include the three extracellular proteases encoded by aprV2, aprV5, and bprV . Research has shown that mutations in fimP significantly reduce the secretion of these proteases, directly linking fimP activity to the production of these important virulence factors.

  • Virulence determination: The virulence properties of D. nodosus isolates, along with climatic conditions, determine the outcome of infection. Under warm, wet conditions, virulent strains cause severe disease . The proper functioning of the fimP enzyme is likely essential for maintaining full virulence capabilities.

  • Potential as therapeutic target: Given its dual role in virulence mechanisms, fimP represents a potential target for anti-virulence strategies aimed at controlling footrot infections. Inhibition of fimP activity could simultaneously impair fimbrial biogenesis and protease secretion, potentially attenuating bacterial virulence without directly killing the bacteria.

How can researchers overcome the toxicity issues when expressing recombinant D. nodosus fimbrial proteins?

Expressing recombinant D. nodosus fimbrial proteins, including fimP, presents significant toxicity challenges to host cells. Researchers have identified several strategies to overcome these issues:

  • Glucose supplementation: Adding 1% glucose to growth media is critical for successful transformation and growth of E. coli harboring D. nodosus fimbrial proteins. In studies with fimbrial subunit genes, transformed BL21 cells could not grow on LB/ampicillin agar without glucose supplementation . Glucose suppresses basal expression from T7-based promoters by catabolite repression.

  • Expression system optimization:

    • Using tightly controlled expression systems with minimal leaky expression

    • Employing lower-copy-number plasmids to reduce basal expression levels

    • Utilizing host strains with reduced T7 RNA polymerase expression

  • Induction strategies:

    • Lower IPTG concentrations (0.1-0.5 mM instead of 1 mM)

    • Lower induction temperatures (16-25°C rather than 37°C)

    • Shorter induction periods, as extended expression leads to significant decline in cell viability

  • Co-expression approaches:

    • Co-expressing chaperones to aid in proper protein folding

    • Co-expressing other components of the fimbrial biogenesis machinery to potentially reduce toxicity

  • Alternative extraction methods: Since the toxic effects appear to be related to membrane association of the expressed proteins, optimizing extraction methods using various detergents (beyond SDS) might help reduce the impact on host cells while improving protein recovery .

The toxicity is likely due to the hydrophobic regions of these proteins associating with or incorporating into vital membrane systems of the host cell, disrupting normal cellular functions .

What are the critical factors for successful complementation assays using fimP?

Complementation assays are valuable tools for studying fimP function, but several critical factors must be considered for successful implementation:

  • Vector selection:

    • Broad-host-range vectors like pMMB67EH are essential for cross-species complementation studies

    • The vector should contain an appropriate promoter (e.g., tac promoter) for controlled expression in the recipient strain

    • Compatible antibiotic resistance markers are needed for selection

  • Recipient strain preparation:

    • A well-characterized pilD mutant of P. aeruginosa (such as PAKDΩ) should be used

    • The mutant strain should have a clear, verifiable phenotype (absence of fimbriae) that can be restored upon complementation

  • Transformation/conjugation procedure:

    • For P. aeruginosa, intergenic matings using E. coli as an intermediate host may be required

    • Triparental mating using helper plasmids carrying transfer functions can improve efficiency

  • Expression verification:

    • RT-PCR or Western blotting to confirm expression of the complementing gene

    • Quantitative analysis to ensure appropriate expression levels

  • Phenotype analysis:

    • Electron microscopy is the gold standard for visualizing restoration of fimbriae

    • Functional assays such as twitching motility can provide additional confirmation

    • Quantitative assessment of fimbrial production may provide more sensitive detection of complementation

  • Controls:

    • Empty vector control (e.g., PAKDΩ(pMMB67EH))

    • Wild-type strain (e.g., P. aeruginosa PAK)

    • Positive control with known complementing gene

The successful complementation of a P. aeruginosa pilD mutant with D. nodosus fimP demonstrates not only functional equivalence but also indicates that FimP can recognize and process heterologous prepilin substrates like the P. aeruginosa PilA protein .

What techniques are most effective for analyzing the transcriptional regulation of fimP and related genes?

Understanding the transcriptional regulation of fimP and related genes requires specialized techniques due to the challenges posed by their operon structure and potential transcript instability. Based on research experience:

These techniques, particularly RT-PCR for operon structure analysis and qRT-PCR for expression level quantification, have proven most effective for studying the complex transcriptional regulation of the fimP gene and related components of the fimbrial biogenesis system.

What are the promising approaches for developing vaccines targeting D. nodosus fimbrial proteins?

Development of vaccines targeting D. nodosus fimbrial proteins represents a promising approach for controlling footrot in sheep and other ruminants. Several strategies show particular promise:

  • Recombinant fimbrial subunit vaccines: Expression and purification of recombinant fimbrial subunit proteins (FimA) has been successfully achieved, providing a foundation for vaccine development. These proteins can be produced in E. coli using expression vectors like pET32a and purified using affinity chromatography .

  • Multi-serogroup formulations: D. nodosus exhibits significant genetic variation in fimbriae across different serogroups. Effective vaccines would need to incorporate fimbrial antigens from multiple serogroups to provide broad protection against field strains . Sequence analysis has identified both serogroup-specific regions and conserved epitopes that could inform rational vaccine design.

  • Adjuvant optimization: Selection of appropriate adjuvants is critical for enhancing immune responses to fimbrial proteins. Future research should investigate which adjuvant formulations maximize both humoral and cell-mediated immunity against fimbrial antigens.

  • Delivery system innovation: Novel delivery systems, including nanoparticle formulations, could improve antigen presentation and stability. Additionally, development of live attenuated strains expressing modified fimbrial proteins might provide more comprehensive immune responses.

  • Combined antigen approaches: Including both fimbrial proteins and secreted proteases in vaccine formulations could target multiple virulence mechanisms simultaneously, potentially providing superior protection compared to single-antigen approaches.

Future research should focus on assessing protective immune responses to recombinant fimbrial proteins in laboratory animals before progressing to trials in target species . This systematic approach would help overcome the challenges posed by serogroup diversity and identify optimal formulations for field deployment.

How might structural studies of fimP inform the development of novel antimicrobials?

Structural studies of fimP could significantly advance the development of novel antimicrobials targeting D. nodosus and potentially other type IV fimbriate pathogens:

  • Active site targeting: Detailed structural information about the active site of fimP, particularly the conserved aspartic acid residues that form the catalytic center , could enable the rational design of specific inhibitors. Since type 4 prepilin peptidases represent a novel family of bilobed aspartate proteases unlike any other protease class, inhibitors targeting their unique structural features might have limited cross-reactivity with host proteases.

  • Substrate-binding pocket analysis: Characterization of the substrate-binding pocket would reveal the molecular basis for substrate specificity. This information could guide the development of peptidomimetic inhibitors that compete with natural substrates but resist cleavage.

  • Allosteric inhibition opportunities: Beyond the active site, structural studies might reveal allosteric sites unique to fimP that could be targeted by small molecules to modulate enzyme activity. These allosteric inhibitors might offer advantages in terms of specificity and reduced potential for resistance development.

  • Structure-based virtual screening: Solved structures of fimP would enable virtual screening of compound libraries to identify potential inhibitors, accelerating the drug discovery process. This approach could identify lead compounds with novel scaffolds for further optimization.

  • Membrane-interaction domains: As a membrane-bound enzyme, fimP likely contains domains that mediate membrane association. Structural characterization of these regions could inform the development of compounds that disrupt proper membrane localization, thereby inhibiting enzyme function.

The dual role of fimP in both fimbrial biogenesis and protease secretion makes it a particularly attractive antimicrobial target, as inhibition would simultaneously impair two major virulence mechanisms of D. nodosus, potentially reducing pathogenicity without directly killing the bacteria (an anti-virulence approach).

What unexplored aspects of the fimP-mediated protease secretion system warrant further investigation?

Several aspects of the fimP-mediated protease secretion system remain unexplored and represent fertile ground for future research:

  • Molecular mechanism of dual functionality: While it's established that fimP and other fimbrial biogenesis components are required for protease secretion , the precise molecular mechanism linking these two processes remains unclear. Structural and functional studies could elucidate how the same machinery accomplishes both tasks.

  • Substrate recognition determinants: Understanding how the system differentiates between fimbrial components and proteases for secretion would provide fundamental insights into bacterial protein secretion mechanisms. This includes identifying potential targeting sequences or chaperones that direct proteases to the secretion apparatus.

  • Evolutionary origin of the dual system: Comparative genomic and phylogenetic analyses could reveal how this dual-function system evolved in D. nodosus. Was it derived from a classical type II secretion system that acquired additional functions, or did the fimbrial biogenesis system evolve protease secretion capabilities independently?

  • Regulatory mechanisms: Investigation of how D. nodosus coordinates and regulates the two functions of this system under different environmental conditions could reveal sophisticated control mechanisms. Are both functions always active simultaneously, or can they be differentially regulated?

  • Protein-protein interactions: Mapping the interactions between fimP and other components of the secretion/biogenesis machinery would identify key molecular interfaces that could be targeted for inhibition. Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking studies could be employed.

  • Host-pathogen interface: Exploring how the secreted proteases and fimbriae interact at the host-pathogen interface could reveal synergistic mechanisms that enhance virulence. Do these two virulence factors act cooperatively during infection?

This unique system in D. nodosus represents a fascinating example of evolutionary adaptation in a specialized pathogen with a small genome, meriting detailed investigation to both advance fundamental understanding of bacterial secretion systems and potentially identify novel therapeutic targets .

Research Methodology Table

Type 4 Prepilin PeptidaseSpeciesFirst Aspartate PositionSecond Aspartate PositionCommentsReference
TcpJVibrio cholerae125189Essential for toxin secretion and pilus formation
VcpDVibrio cholerae147212Secondary TFPP in V. cholerae
PilDPseudomonas aeruginosaConservedConservedDual peptidase and N-methyltransferase activity
FimPDichelobacter nodosusConserved (position not specified)Conserved (position not specified)Functionally equivalent to PilD

This table highlights the conservation of the critical aspartate residues across different type 4 prepilin peptidases. While the exact positions of these residues in D. nodosus FimP are not specified in the available literature, they are expected to be conserved based on functional complementation studies and the essential nature of these residues for enzymatic activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.