Recombinant Dichelobacter nodosus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

Enzymatic Activity:
uppP hydrolyzes undecaprenyl diphosphate (C55-isoprenyl diphosphate\text{C}_{55}\text{-isoprenyl diphosphate}) into undecaprenyl phosphate (C55-isoprenyl phosphate\text{C}_{55}\text{-isoprenyl phosphate}) and inorganic phosphate (Pi\text{P}_i):

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}

Activity is calcium-dependent, with Ca2+\text{Ca}^{2+} enhancing catalysis .

Antibiotic Resistance:
uppP confers resistance to bacitracin by recycling undecaprenyl phosphate, a lipid carrier sequestered by bacitracin during peptidoglycan synthesis .

Research Applications

  • ELISA and Immunoassays: Used as an antigen to study antibody responses in D. nodosus infections .

  • Bacitracin Resistance Studies: Facilitates mechanistic investigations into lipid carrier recycling .

  • Structural Biology: Homology modeling and crystallization trials (e.g., PDB IDs: 5OON, 6CB2 for E. coli homologs) inform drug design .

Key Research Findings

  • Vaccine Development: While not directly tested as a vaccine antigen, antisera against D. nodosus whole-cell vaccines cross-react with uppP, suggesting immunogenicity .

  • Lysozyme Inhibition: Though not a lysozyme inhibitor itself, studies on related D. nodosus proteins (e.g., Dn-ACP) highlight the utility of recombinant systems for virulence factor analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; DNO_0291; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Dichelobacter nodosus (strain VCS1703A)
Target Names
uppP
Target Protein Sequence
MTLWQAFILSLIQGITEFLPISSSGHLVITRELLHWQDAGVAFDAFTGLGTLTAVLFYYR KDVCSILYHWFRQFRHCDAPPAPEAKLGNQLIVATLPALLIGFMVKDHIDALTHRPLLIA STTMIFAIFLAAADFWGRKKLSLPETNYRQAFYYGLAQTLALVPGVSRSGITLTAGLAMH FSRESAARFSFLQSIPISAAAGGYGLWKLATNPSDFSWQLIALSYVTATLAAYVCIALFI RFLNTVGMMPHVIYRLLLGAYLFFVFM
Uniprot No.

Target Background

Function

Function: Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.

Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Dichelobacter nodosus and why is it significant in research?

Dichelobacter nodosus is a gram-negative bacterium primarily known as the causative agent of footrot in sheep, a significant infectious disease affecting livestock worldwide. This pathogen has been extensively studied due to its economic impact on the sheep industry. D. nodosus is traditionally identified through its virulence factors, with several strains demonstrating varying degrees of pathogenicity . The bacterium's virulence can be assessed through laboratory tests including elastase production after 7-10 days of incubation on elastin agar and positive results in gelatin-gel protease stability tests . The organism's significance in research extends beyond veterinary science into bacterial pathogenesis and antimicrobial target discovery, as it possesses several potential drug targets including undecaprenyl-diphosphatase (uppP).

What role does Undecaprenyl-diphosphatase (uppP) play in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase (uppP) is a critical enzyme in the bacterial cell wall biosynthesis pathway. This enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) . The biosynthetic pathway begins with the conversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP) to farnesyl diphosphate (FPP) through the action of farnesyl diphosphate synthase (FPPS) . Following this, FPP condenses with 8 additional IPP molecules to form (C55) undecaprenyl diphosphate (UPP) in a reaction catalyzed by undecaprenyl diphosphate synthase (UPPS) . Finally, UPP is converted by uppP to undecaprenyl phosphate (UP), which serves as a critical carrier molecule for peptidoglycan precursors during cell wall synthesis . This biosynthetic pathway is essential for bacterial survival, making uppP a potential target for antimicrobial development.

What is the structural composition of Dichelobacter nodosus uppP?

The undecaprenyl-diphosphatase (uppP) from Dichelobacter nodosus (strain VCS1703A) is composed of 267 amino acids with a specific sequence as documented in protein databases. The amino acid sequence begins with MTLWQAFILSLIQGITEFLP and continues with residues that form the complete functional protein . The protein's structure features characteristics typical of membrane-associated enzymes, including transmembrane regions that anchor it to the bacterial cell membrane. The uppP protein is alternatively known as Bacitracin resistance protein, highlighting its role in antibiotic resistance mechanisms . The gene encoding this protein is designated as uppP (DNO_0291) in the D. nodosus genome . Understanding this structural composition is crucial for researchers working on protein expression, purification, and functional characterization studies.

How does uppP relate to antimicrobial resistance mechanisms?

Undecaprenyl-diphosphatase (uppP) in D. nodosus, like in other bacteria, plays a significant role in antimicrobial resistance, particularly against antibiotics targeting cell wall synthesis. The enzyme is alternatively named "Bacitracin resistance protein," indicating its specific function in providing resistance against this particular antibiotic . Bacitracin works by binding to undecaprenyl pyrophosphate, thereby preventing its dephosphorylation by uppP and subsequently inhibiting cell wall synthesis. When uppP is overexpressed or modified, bacteria can overcome this inhibition, continuing cell wall production despite the presence of the antibiotic. This mechanism represents one of the many ways bacteria develop resistance to antimicrobials, making uppP an important target for both understanding resistance mechanisms and developing novel therapeutic approaches that might circumvent this resistance.

What expression systems are optimal for producing recombinant D. nodosus uppP?

The expression of recombinant D. nodosus proteins, including uppP, presents several challenges that researchers must address through careful selection of expression systems. Based on related research with D. nodosus proteins, the E. coli BL21(DE3) expression system has been utilized successfully, though with important considerations . When expressing recombinant D. nodosus fimbrial proteins, researchers observed that the target protein exhibited toxicity to host BL21 cells, requiring the addition of 1% glucose to the growth medium to maintain viability . Additionally, the expression system selection should account for potential membrane association of the uppP protein, given its role in bacterial cell envelope processes.

The pET expression systems (such as pET32a) have been employed for D. nodosus proteins, utilizing fusion tags such as thioredoxin (Trx) and polyhistidine (6x-His) to facilitate detection and purification . These fusion systems have proven effective in producing detectable amounts of recombinant protein, with the expressed fusion proteins typically presenting at the expected molecular weight (approximately 35 kDa for fimbrial protein fusions) . When designing expression experiments for uppP, researchers should anticipate potential toxic effects on host cells and consider controlled induction protocols using IPTG at optimized concentrations and temperatures.

How can researchers address toxicity issues when expressing recombinant D. nodosus proteins?

Expression of D. nodosus proteins, including uppP, often presents toxicity challenges that must be mitigated through strategic approaches. Evidence from related work with D. nodosus fimbrial proteins demonstrates that recombinant proteins with hydrophobic regions can have toxic effects on host cells, likely due to association with or incorporation into vital membrane systems . Several strategies can address these toxicity issues:

  • Growth medium supplementation: Adding 1% glucose to the growth medium can help maintain viability of transformed cells, as demonstrated with BL21 cells expressing D. nodosus fimbrial proteins .

  • Controlled induction protocols: Monitoring cell growth (OD600) during expression and implementing careful IPTG induction protocols can help manage toxicity. Research has shown a sizeable decline in viability and division of recombinant BL21 cells post-induction, visible as declining turbidity compared to uninduced controls .

  • Fusion partner selection: Using appropriate fusion partners can sometimes mitigate toxicity. The thioredoxin (Trx) fusion system has been employed successfully with D. nodosus proteins .

  • Induction timing and temperature optimization: Controlling the timing and conditions of induction can help balance protein expression with cell viability.

Researchers should anticipate potential inability of induced cells to form colonies on solid media due to cell lysis, as observed with some D. nodosus proteins . These toxicity management strategies are essential for successful recombinant uppP production.

What approaches are effective for purifying recombinant D. nodosus uppP?

Purification of recombinant D. nodosus uppP requires specialized techniques to address the membrane-associated nature of this protein. Based on related research with D. nodosus proteins, the following purification approach has proven effective:

  • Cell lysis optimization: Treatment of bacterial pellets with appropriate lysis buffers (such as CelLyticB) is crucial for initial protein extraction . For membrane-associated proteins like uppP, addition of detergents may be necessary to release the protein from membrane structures.

  • Affinity chromatography: Ni-NTA affinity chromatography under native conditions has been successfully employed for purifying His-tagged D. nodosus proteins . The protocol typically involves:

    • Adding 1 ml of 50% Ni-NTA slurry to 4 ml cleared lysate

    • Gentle mixing (200 rpm) at 4°C for 60 minutes

    • Column loading and collection of flow-through

    • Washing twice with 4 ml wash buffer

    • Elution with 0.5 ml elution buffer (multiple fractions)

  • Protein verification: SDS-PAGE analysis of different fractions helps assess purity, with Western blotting using Ni-NTA HRP conjugate confirming the identity of His-tagged recombinant proteins .

Research indicates that increasing incubation time post-induction and employing repeated freeze-thawing of cell lysates can increase the yield of recombinant D. nodosus proteins . For uppP specifically, careful optimization of detergent types and concentrations is likely necessary due to its membrane association.

How can researchers analyze contradictory data in uppP inhibition studies?

When researchers encounter contradictory data in uppP inhibition studies, a systematic approach to data analysis is essential. The process should begin with thoroughly examining the data to identify specific discrepancies . This involves comparing expected results with actual findings and pinpointing inconsistencies that contradict the initial hypothesis . Researchers should pay particular attention to outliers that may significantly influence the results, as these data points could either indicate experimental error or reveal important biological phenomena .

A comprehensive approach to resolving contradictory findings includes:

  • Data validation: Review experimental procedures, reagent quality, and equipment calibration to rule out technical issues.

  • Variable reassessment: Evaluate the initial assumptions about uppP function and inhibition mechanisms. Consider whether the contradictory data suggests alternative mechanisms of action.

  • Experimental redesign: Modify the data collection process if necessary, refining variables and implementing additional controls . This might include testing uppP inhibition under different conditions or using alternative assay methods.

  • Literature comparison: Compare findings with existing studies on bacterial diphosphatases and related enzymes to contextualize the unexpected results.

By approaching contradictory data with an open mind, researchers can transform unexpected findings into new discoveries about uppP function and inhibition mechanisms .

What methods can be used to study the role of uppP in D. nodosus pathogenicity?

Investigating the role of uppP in D. nodosus pathogenicity requires specialized genetic and functional approaches. Building upon established methodologies for studying D. nodosus virulence factors, researchers can employ several strategies:

  • Genetic transformation: Recent advances have demonstrated that D. nodosus strains are naturally transformable, allowing for genetic manipulation . This transformability enables researchers to insert modified genes into the chromosome through double-reciprocal crossover events .

  • Reverse genetics: Using tools such as the tetracycline resistance gene (tet(M)) on suicide plasmids, researchers can create targeted gene knockouts or modifications of the uppP gene to assess its contribution to pathogenicity .

  • Virulence assessment: Modified strains can be evaluated using established virulence indicators:

    • Elastase production after 7-10 days of incubation on elastin agar

    • Gelatin-gel protease stability testing

    • Pen virulence trials in sheep to assess footrot development

  • Comparative analysis: Comparing wild-type and uppP-modified strains can reveal differences in cell wall integrity, antibiotic susceptibility, and virulence factor expression.

Selection of appropriate D. nodosus strains is crucial, with virulent strains like VCS1703A providing useful models as they possess properties associated with virulent isolates and have demonstrated capability to produce virulent footrot in sheep during pen trials .

How should researchers design experiments to evaluate potential uppP inhibitors?

Designing robust experiments to evaluate potential uppP inhibitors requires a systematic approach that addresses both enzymatic activity and bacterial viability. The experimental design should include:

  • Enzyme assay development: Establish a reliable in vitro assay for measuring uppP activity, typically using purified recombinant enzyme. The assay should monitor the conversion of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) . Consider using radiolabeled substrates or colorimetric detection of released phosphate.

  • Inhibitor screening: Test compounds should be evaluated in a concentration-dependent manner to determine IC50 values. Compounds targeting UPPS have been reported (including tetramic/tetronic acids, diamidines, and benzoic acids) and may serve as starting points or controls .

  • Specificity assessment: Test inhibitors against related bacterial phosphatases to determine target selectivity. This includes evaluating activity against human phosphatases to assess potential toxicity.

  • Whole-cell activity testing: Evaluate inhibitors against D. nodosus cultures, measuring growth inhibition, changes in cell morphology, and cell wall integrity. Incorporate control compounds with known mechanisms of action.

  • Resistance development monitoring: Assess the potential for resistance development through serial passage experiments in sub-inhibitory concentrations of lead compounds.

The experimental design should include appropriate controls, such as known cell wall biosynthesis inhibitors (e.g., bacitracin) and negative controls (solvent only). Statistical analysis should be rigorously applied to all data, with experiments performed in triplicate to ensure reproducibility.

What controls are essential in transformation studies involving D. nodosus uppP?

When conducting transformation studies involving D. nodosus uppP, several critical controls must be implemented to ensure experimental validity:

  • Positive transformation control: Include a well-characterized plasmid known to successfully transform D. nodosus, such as those containing the tetracycline resistance gene (tet(M)) . This validates that the transformation conditions are suitable.

  • Negative transformation control: Perform transformation procedures without DNA to confirm that any observed transformants are not spontaneous mutants or contaminants.

  • Vector-only control: Transform cells with the empty vector (without uppP modifications) to distinguish effects specific to uppP alterations from those related to the vector itself.

  • Wild-type strain controls: Include the unmodified parent strain in all phenotypic and functional assays to provide a direct comparison baseline.

  • Genotype verification controls: Implement PCR and sequencing verification of transformants using primers flanking the integration site, with appropriate positive and negative controls for these verification methods .

For studies involving virulence assessment, researchers should include control strains with known virulence profiles, such as VCS1703A which has been shown to produce virulent footrot in sheep during pen trials . These comprehensive controls ensure that any observed effects can be confidently attributed to specific modifications of the uppP gene.

How can researchers optimize the production of recombinant D. nodosus uppP?

Optimizing the production of recombinant D. nodosus uppP requires addressing several challenges specific to membrane-associated bacterial proteins. Based on experience with similar D. nodosus proteins, researchers should consider the following optimization strategies:

  • Expression system modification: As observed with D. nodosus fimbrial proteins, the addition of 1% glucose to growth media can help maintain viability of transformed BL21 cells experiencing toxicity from recombinant protein expression .

  • Induction protocol refinement: Monitor cell growth (OD600) carefully and adjust IPTG concentration and induction timing to balance protein expression with cell viability. Research with D. nodosus proteins has shown marked decline in cell growth following induction .

  • Post-induction processing: Evidence indicates that increasing incubation time post-induction and employing repeated freeze-thawing of cell lysates can increase the yield of recombinant D. nodosus proteins .

  • Protein extraction enhancement: For membrane-associated proteins like uppP, optimize detergent selection and concentration in lysis buffers to efficiently release the protein from cellular membranes.

  • Purification protocol optimization: Fine-tune Ni-NTA affinity chromatography conditions, including binding time, wash buffer composition, and elution conditions to maximize purity while maintaining protein activity .

These optimization approaches should be systematically tested and validated through SDS-PAGE analysis and Western blotting to confirm identity, as has been successfully applied to other D. nodosus proteins .

What techniques are most effective for analyzing uppP activity in vitro?

Analyzing uppP activity in vitro requires specialized techniques that account for the enzyme's membrane association and specific substrate requirements. Effective analytical approaches include:

  • Phosphate release assays: Measure the release of inorganic phosphate when uppP dephosphorylates undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) . This can be quantified using colorimetric methods such as malachite green assays.

  • HPLC analysis: High-performance liquid chromatography can separate and quantify both substrate (UPP) and product (UP) to directly measure enzymatic conversion rates.

  • Radioactive substrate assays: Using radiolabeled UPP allows for highly sensitive detection of enzymatic activity through scintillation counting of released phosphate or quantification of radiolabeled UP product.

  • Reconstituted membrane systems: Since uppP is a membrane protein, reconstituting the purified enzyme in liposomes or nanodiscs can provide a more physiologically relevant environment for activity assessment.

  • Coupled enzyme assays: Design assays that couple the release of phosphate to secondary enzymatic reactions with easily detectable outputs.

For all these analytical methods, researchers should establish appropriate controls, including heat-inactivated enzyme, substrate-only reactions, and known inhibitors of uppP activity. Standard curves should be generated for quantification, and assay conditions (pH, temperature, cation requirements) should be systematically optimized to determine the enzyme's biochemical properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.