Recombinant Dickeya dadantii NADH-quinone oxidoreductase subunit K (nuoK)

What is Dickeya dadantii and why is it significant in plant pathology?

Dickeya dadantii is a bacterial pathogen that causes soft rot disease in a wide range of plant species across temperate, subtropical, and tropical regions worldwide. It is particularly significant as it infects economically important crops, including potatoes. The bacteria feed on plant roots, tubers, stems, and leaves, causing wilting and soft rot symptoms. Dickeya dadantii is more aggressive than other blackleg-causing bacteria, as it spreads more readily through the plant's vascular tissue and can cause disease at higher temperatures than other similar pathogens .

What is the function of NADH-quinone oxidoreductase subunit K in bacterial systems?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of respiratory complex I (NADH:ubiquinone oxidoreductase), which plays a crucial role in bacterial energy metabolism. This enzyme complex catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane. NuoK specifically functions as a membrane-embedded subunit (EC 1.6.99.5) that contributes to proton translocation and energy conservation. In Dickeya dadantii, this 100-amino acid protein (UniProt: C6C9P6) comprises primarily hydrophobic residues forming transmembrane domains essential for maintaining the structural integrity and functional activity of the respiratory complex .

How does the structure of nuoK contribute to its function in NADH oxidoreductase activity?

The structure of nuoK is characterized by a predominantly hydrophobic amino acid composition (sequence: MIPLQHGLLLAAILFVLGLTGLVIRRNLLFMLISLEIMISALAFVVAGSYWGQSDGQVMYILAITLAAAEASIGLALLLQLYRRRQTLNIDTVSEMRG), resulting in multiple transmembrane domains. NuoK adopts a helical conformation, particularly in its membrane-spanning regions. These helical structures are critical for proper insertion into the bacterial membrane and interaction with other components of the NADH-quinone oxidoreductase complex. The transmembrane helices of nuoK likely participate in forming the proton translocation pathway within complex I, contributing to the establishment of the proton gradient across the membrane that drives ATP synthesis .

How does the expression of nuoK vary under different environmental conditions during infection?

Expression profiling of respiratory chain components like nuoK during Dickeya dadantii infection reveals conditional regulation patterns:

The expression of respiratory chain components typically responds to oxygen availability, nutrient status, and host defense responses. During plant infection, Dickeya dadantii encounters varying microenvironments that necessitate metabolic adaptation. The bacteria likely modulate nuoK expression as part of this adaptation to optimize energy production under changing conditions, although specific regulatory mechanisms controlling nuoK expression during infection require further investigation .

What expression systems are most effective for producing recombinant Dickeya dadantii nuoK?

For efficient expression of recombinant Dickeya dadantii nuoK, several expression systems have been evaluated:

Best practices for expressing recombinant nuoK include:

• Using low-temperature induction (16-20°C)

• Including membrane-stabilizing additives in the growth medium

• Employing fusion tags that enhance solubility (MBP, SUMO)

• Utilizing specialized vectors with tunable promoter strength

When expressing membrane proteins like nuoK, maintaining the balance between expression rate and membrane insertion capacity is critical for obtaining functional protein .

What purification strategies yield the highest purity and activity for recombinant nuoK?

The purification of recombinant nuoK requires specialized approaches due to its membrane-protein nature:

• Membrane protein extraction:

  • Use mild detergents (DDM, LMNG, or Triton X-100) for membrane solubilization

  • Optimize detergent concentration to maintain protein structure while ensuring solubilization

• Affinity chromatography:

  • His-tag purification using Ni-NTA resin with detergent in all buffers

  • Gentle elution conditions to prevent protein aggregation

• Size exclusion chromatography:

  • Final polishing step to separate monomeric from aggregated protein

  • Ensures homogeneity of the final sample

• Activity preservation considerations:

  • Include stabilizing lipids (E. coli polar lipids or synthetic phospholipids)

  • Maintain appropriate pH (typically 7.0-8.0) and ionic strength

  • Consider reconstitution into nanodiscs or liposomes for functional studies

The choice of detergent is particularly critical, as it must effectively solubilize the membrane protein while maintaining its native fold and activity .

What analytical methods are most informative for characterizing the structure-function relationship of recombinant nuoK?

Several analytical approaches provide valuable insights into nuoK structure-function relationships:

When characterizing membrane proteins like nuoK, combining structural techniques with functional assays provides the most comprehensive understanding. For example, site-directed mutagenesis of conserved residues followed by activity measurements can identify functionally critical regions of the protein .

How does research on nuoK complement studies on Dickeya dadantii virulence factors?

While nuoK itself is not a direct virulence factor like those secreted through the T2SS or T3SS, understanding nuoK function provides important context for virulence factor research:

• Energy-virulence connection:
  The respiratory chain, including nuoK, generates the energy needed for virulence factor synthesis and secretion. Studies have shown that disruption of energy metabolism can attenuate bacterial virulence.

• Environmental adaptation:
  Both nuoK function and virulence factor expression respond to environmental signals encountered during infection. For example, oxygen limitation affects both respiratory chain composition and virulence factor expression.

• Regulatory network overlaps:
  Recent research has identified cyclic-di-GMP as a regulator of the T3SS in Dickeya dadantii, and this second messenger often coordinates multiple cellular processes including aspects of energy metabolism .

Investigating the links between cellular energetics (involving nuoK) and virulence factor expression could reveal new targets for disease control strategies.

What techniques allow researchers to study the in planta activity of nuoK during Dickeya dadantii infection?

Studying nuoK activity within the plant environment requires specialized approaches:

When studying nuoK during infection, researchers typically employ both transcriptomic and proteomic approaches, often combined with mutant analysis. For example, comparing the transcriptional profile of wild-type Dickeya dadantii with respiratory chain mutants during infection can reveal how energy metabolism adapts to the host environment .

How might targeting nuoK function present a novel approach to controlling Dickeya dadantii infections?

Targeting bacterial respiratory chains represents an underexplored strategy for controlling plant pathogens like Dickeya dadantii:

• Potential advantages:

  • Essential function for bacterial viability

  • Distinct from eukaryotic respiratory components

  • Central role in supporting virulence mechanisms

• Intervention strategies:

  • Small molecule inhibitors specific to bacterial NADH-quinone oxidoreductase

  • Peptide-based inhibitors targeting nuoK-specific protein interactions

  • Interference with nuoK assembly into the respiratory complex

• Challenges:

  • Delivery of inhibitors to infection sites

  • Potential off-target effects on beneficial microbiota

  • Development of resistance mechanisms

Preliminary research in related bacterial systems suggests that respiratory chain inhibitors can effectively reduce bacterial growth and virulence with minimal impact on host physiology when appropriately targeted .

What are the key unresolved questions about nuoK structure and function in Dickeya dadantii?

Despite progress in understanding bacterial respiratory chains, several key questions about Dickeya dadantii nuoK remain unanswered:

• High-resolution structure:

  • How does nuoK's structure in Dickeya dadantii compare to homologs in other bacteria?

  • What specific residues form the proton translocation pathway?

• Regulatory mechanisms:

  • How is nuoK expression regulated during different stages of infection?

  • Do post-translational modifications affect nuoK function during stress?

• Complex assembly:

  • What is the temporal sequence of respiratory complex assembly involving nuoK?

  • Are there Dickeya-specific features of respiratory complex architecture?

• Host interactions:

  • Does plant immunity target bacterial respiratory functions during infection?

  • How does nuoK function adapt to plant-specific microenvironments?

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular genetics, and plant pathology .

How can advanced techniques like cryo-EM and mass spectrometry be optimized for studying nuoK in complex with other respiratory chain components?

Optimizing advanced techniques for nuoK research requires specific considerations:

For Cryo-EM:

• Sample preparation optimization:

  • Detergent screening for optimal complex stability

  • Vitrification conditions preserving native state

  • Grid types minimizing preferential orientation

• Data collection strategies:

  • Tilt series to overcome orientation bias

  • Dose fractionation to mitigate radiation damage

  • Phase plate usage for contrast enhancement

For Mass Spectrometry:

• Special considerations for membrane proteins:

  • Modified digestion protocols for hydrophobic proteins

  • Specialized ionization techniques

  • Cross-linking MS for interaction mapping

• Quantitative approaches:

  • SILAC or TMT labeling for comparative studies

  • Parallel reaction monitoring for targeted analysis

  • Hydrogen-deuterium exchange for conformational analysis

These techniques, when properly optimized, can provide unprecedented insights into nuoK structure, interactions, and dynamics within the respiratory complex .

What interdisciplinary approaches could accelerate understanding of the role of nuoK in Dickeya dadantii pathogenicity?

Integrating multiple disciplines could significantly advance nuoK research:

Collaborative research combining these approaches could reveal:

• How respiratory function coordinates with virulence mechanisms

• Energy-dependent regulation of pathogenicity

• Potential metabolic vulnerabilities during infection

• Novel targets for disease management strategies

Additionally, comparing nuoK function across different Dickeya species and strains could provide evolutionary insights into pathogen adaptation .