Recombinant Dickeya zeae L-alanine exporter AlaE (alaE)

Shipped with Ice Packs
In Stock

Description

Biological Role of AlaE in Bacterial Physiology

AlaE is a small transmembrane protein (149 amino acids in E. coli) that exports intracellular L-alanine to prevent toxic accumulation under peptide-rich environments, such as animal intestines . Key functions include:

  • Toxin Mitigation: AlaE-deficient E. coli mutants exhibit hypersensitivity to L-alanyl-L-alanine (MIC reduced by >4,000-fold) .

  • Substrate Specificity: Primarily exports L-alanine but also shows activity toward D-alanine under elevated intracellular conditions .

  • Regulation: Expression is positively regulated by the global transcriptional regulator Lrp in the presence of L-alanine and L-leucine .

Recombinant Production of E. coli AlaE

While Dickeya zeae AlaE remains uncharacterized, recombinant E. coli AlaE has been extensively studied. Key specifications include:

Hypothetical Insights for Dickeya zeae AlaE

Dickeya zeae is a phytopathogen causing soft rot in crops like rice and banana . Genomic analyses reveal:

  • Metabolic Pathways: D. zeae encodes multiple amino acid transporters and virulence-associated systems (e.g., T3SS, T6SS) .

  • Regulatory Mechanisms: Global regulators like OhrR and c-di-GMP modulate virulence and biofilm formation .

If D. zeae possesses an AlaE homolog, its recombinant form might:

  • Mitigate Alanine Toxicity: Similar to E. coli, AlaE could protect D. zeae during host infection by exporting excess alanine.

  • Enhance Virulence: Alanine cross-feeding might support bacterial survival in nutrient-deprived plant tissues .

Research Gaps and Future Directions

  1. Genomic Homology: No AlaE homolog has been annotated in D. zeae genomes . Comparative genomics with E. coli could identify potential candidates.

  2. Functional Studies: Heterologous expression of D. zeae transporters in E. coli mutants (e.g., ΔalaE) could test alanine export activity .

  3. Pathogenicity Links: Testing recombinant AlaE in D. zeae virulence models (e.g., rice infection assays) may clarify its role .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
alaE; Dd1591_0599; L-alanine exporter AlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Dickeya chrysanthemi (strain Ech1591) (Dickeya zeae (strain Ech1591))
Target Names
alaE
Target Protein Sequence
MFSPLSRIRGIVADTVAMVVYCFLTGMAIEIVLSDMSFQQSLSSRLLSIPVNIVIAWPYG LYRDRIVALALRLNADSRWGKNIADLFAYVSFQSPVYVAILLTIGAEPSQILKAVASNAV ISMVMGVAYGYFLEYCRRLFRVSVSPRPQIVSH
Uniprot No.

Target Background

Function
This protein facilitates the export of L-alanine.
Database Links
Protein Families
AlaE exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Dickeya zeae and what plant diseases does it cause?

Dickeya zeae is a bacterial plant pathogen of the family Pectobacteriaceae responsible for economically significant crop diseases. It causes soft rot of taro (Colocasia esculenta), heart rot of pineapple (Ananas comosus), and various diseases in potato, maize, rice, banana, and ornamental plants. This pathogen significantly reduces crop production across multiple agricultural sectors. The bacterium employs various pathogenicity mechanisms including secretion systems and cell wall-degrading enzymes to facilitate host invasion and colonization .

What is the genomic structure of Dickeya zeae strains?

Complete genome analyses of D. zeae strains reveal high-quality genomes with the following characteristics:

  • PL65 strain (from taro): 4.74997 MB genome size; 701x sequencing depth; 53.6% GC content

  • A5410 strain (from pineapple): 4.7792 MB genome size; 558x sequencing depth; 53.5% GC content

These genomes demonstrate significant diversity among D. zeae strains, with average nucleotide identity (ANI) values ranging from 94.33% to 96.27% and digital DNA–DNA hybridization (dDDH) values between 56% and 68.20% . This diversity indicates potential adaptation to different host environments and pathogenicity mechanisms that would affect the expression and function of proteins like AlaE.

What is the L-alanine exporter AlaE and what is its significance in bacterial physiology?

The L-alanine exporter AlaE is a membrane transport protein responsible for exporting excess L-alanine from bacterial cells. In bacterial systems, this protein plays a crucial role in maintaining amino acid homeostasis by preventing toxic accumulation of L-alanine in the cytoplasm. The recombinant expression and study of AlaE from Dickeya zeae provides valuable insights into bacterial physiology, particularly regarding how plant pathogens regulate their internal amino acid concentrations during infection processes and environmental stress responses.

How does the genetic sequence of AlaE in Dickeya zeae compare to other bacterial species?

The genetic conservation of AlaE exporters across bacterial species reflects their biological importance. In Dickeya zeae, genomic analyses demonstrate that this pathogen has considerable genetic diversity compared to other Dickeya species, with proteome comparisons showing average protein family similarity among D. zeae genomes ranging from 71.5% to 77.8% . Pairwise comparison of protein-coding genes among 14 Dickeya genomes reveals shared proteins ranging from 51.1% to 77.8%, with the highest similarity (77.8%) observed between the PL65 and Ech586 D. zeae genomes, both isolated from hosts in the Araceae family .

How does phylogenetic analysis inform our understanding of AlaE evolution across Dickeya species?

Phylogenetic analyses based on virulence-associated genes and whole genome comparisons reveal that D. zeae forms a distinct clade within the Dickeya genus. D. zeae strains cluster together and share the highest DNA homology with D. chrysanthemi Ech1591 (dDDH 30.40–30.9%; ANI 87.24–87.59%) . The evolutionary divergence observed in D. zeae likely reflects adaptation to different host environments, which would potentially affect membrane transporters like AlaE that interface with the external environment.

What are the optimal conditions for recombinant expression of Dickeya zeae AlaE?

For optimal recombinant expression of D. zeae AlaE, researchers should consider the following methodology:

  • Expression system: Escherichia coli BL21(DE3) strain is recommended due to its reduced protease activity and compatibility with T7 promoter-driven expression systems.

  • Expression vector: pET-based vectors with a C-terminal or N-terminal affinity tag (His6 or Strep-tag) facilitate purification while minimizing interference with protein folding.

  • Culture conditions:

    • Growth medium: LB or 2xYT supplemented with appropriate antibiotics

    • Induction: 0.5-1.0 mM IPTG at OD600 0.6-0.8

    • Post-induction temperature: 16-18°C for 16-18 hours (reduced temperature minimizes inclusion body formation for membrane proteins)

  • Membrane fraction preparation: Cell disruption by sonication or French press, followed by differential centrifugation to isolate membrane fractions.

What purification strategies are most effective for obtaining functional recombinant D. zeae AlaE?

Purification of functional recombinant D. zeae AlaE requires specialized approaches for membrane proteins:

  • Solubilization: Membrane fractions should be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations of 1-2% w/v.

  • Affinity chromatography: Using Ni-NTA or Strep-Tactin columns depending on the affinity tag employed, with detergent concentration maintained above critical micelle concentration (CMC) throughout purification.

  • Size exclusion chromatography: For further purification and assessment of protein homogeneity using a Superdex 200 column.

  • Buffer optimization: Final buffer composition typically includes 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and detergent at 2-3× CMC.

  • Protein quality assessment: SDS-PAGE, Western blotting, and circular dichroism to confirm purity and proper folding.

What methods are used to assess the transport activity of recombinant AlaE in vitro?

The transport activity of recombinant AlaE can be assessed using several complementary approaches:

  • Liposome reconstitution assay:

    • AlaE is reconstituted into liposomes with controlled internal/external solutions

    • Transport is initiated by establishing L-alanine concentration gradient

    • Samples are collected at defined time intervals

    • L-alanine concentration is quantified using HPLC or specific enzymatic assays

  • Fluorescence-based transport assays:

    • Using pH-sensitive or ion-sensitive fluorescent probes to detect transport-coupled pH or ion changes

    • Real-time monitoring of transport activity under varying conditions

  • Substrate specificity determination:

    • Competition assays with various amino acids and analogues

    • IC50 determination for transport inhibitors

How does the function of recombinant AlaE compare to its native form in Dickeya zeae?

When comparing recombinant AlaE to its native form, researchers should consider:

  • Transport kinetics: Determine Km and Vmax values for both recombinant and native forms using identical assay conditions.

  • Substrate specificity profiles: Native AlaE in bacterial membrane vesicles may exhibit different specificity compared to recombinant purified protein due to the influence of the lipid environment.

  • Post-translational modifications: Native AlaE may undergo modifications not present in recombinant systems, potentially affecting function.

  • Protein-protein interactions: In the native environment, AlaE may interact with other membrane proteins that influence its activity.

A comprehensive comparison would involve parallel isolation of native membranes from D. zeae and preparation of proteoliposomes containing recombinant protein for transport assays under identical conditions.

How does AlaE contribute to Dickeya zeae virulence mechanisms?

The contribution of AlaE to D. zeae virulence likely involves amino acid homeostasis during infection. Comparative genomic analyses of D. zeae strains show various virulence mechanisms, including secretion systems and cell wall-degrading enzymes like pectate lyases (Pels), cellulases, and proteases (Prt) . While AlaE is not directly mentioned in the provided search results, amino acid exporters like AlaE may play important roles in:

  • Maintaining intracellular amino acid balance during rapid growth in host tissues

  • Adapting to changing nutrient environments encountered during infection

  • Potentially modulating host responses by altering the amino acid composition in the infection site

When studying AlaE's role in virulence, researchers should consider using knockout mutants and complementation studies to evaluate changes in virulence phenotypes on host plants like taro and pineapple.

Is there evidence that AlaE expression varies across Dickeya zeae strains from different host plants?

Based on comparative genomic analyses, D. zeae strains show significant genomic diversity, with proteome comparisons indicating average protein family similarity ranging from 71.5% to 77.8% . This diversity suggests potential variation in AlaE expression or structure across strains adapted to different hosts.

The highest sequence identity (77.8%) was observed between strains isolated from the Araceae family (PL65 from taro and Ech586 from philodendron) , suggesting that closely related hosts may select for similar protein expression patterns. To conclusively determine if AlaE expression varies among strains, researchers should conduct:

  • RNA-seq analyses of different D. zeae strains during infection of their respective hosts

  • Quantitative PCR targeting the alaE gene across multiple strains

  • Western blot analyses using AlaE-specific antibodies to compare protein levels

What structural biology techniques are most appropriate for determining AlaE structure?

For determining the three-dimensional structure of D. zeae AlaE, researchers should consider these methodological approaches:

  • X-ray crystallography:

    • Challenges: Obtaining well-diffracting crystals of membrane proteins

    • Strategy: Vapor diffusion methods with specialized detergents like maltose neopentyl glycol (MNG) compounds

    • Crystallization screening: Using commercial membrane protein screens with lipidic additives

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: No crystallization required, visualization in near-native environment

    • Sample preparation: Vitrification of purified AlaE in detergent micelles or nanodiscs

    • Data collection: Using direct electron detectors and phase plates for improved contrast

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Application: Particularly useful for studying dynamics and ligand interactions

    • Requirements: Isotope-labeled protein (13C, 15N, 2H)

    • Best for: Targeted studies of specific domains rather than full-length protein

How can site-directed mutagenesis be applied to identify critical residues for AlaE function?

Site-directed mutagenesis provides a powerful approach to identify functional residues in AlaE through the following methodological workflow:

  • In silico analysis:

    • Multiple sequence alignment of AlaE homologs to identify conserved residues

    • Homology modeling based on related transporters with known structures

    • Identification of potential substrate binding and translocation pathway residues

  • Mutagenesis strategy:

    • Alanine scanning of conserved residues in transmembrane domains

    • Charge reversal mutations for charged residues

    • Conservative substitutions to probe specific interactions

  • Functional characterization of mutants:

    • Expression level and membrane localization verification

    • Transport activity assays comparing wild-type and mutant proteins

    • Determination of kinetic parameters for functional mutants

  • Data analysis and interpretation:

    • Classification of mutations into those affecting expression, localization, or catalytic function

    • Construction of a functional model of the transport mechanism

How might understanding AlaE function contribute to developing new antimicrobial strategies?

Understanding AlaE function could lead to novel antimicrobial strategies through several research applications:

  • Inhibitor development:

    • Designing specific inhibitors targeting AlaE to disrupt amino acid homeostasis

    • High-throughput screening of compound libraries against purified AlaE

    • Structure-based drug design using solved AlaE structures

  • Metabolic vulnerability exploitation:

    • Identification of conditions where AlaE function becomes essential for bacterial survival

    • Development of combination therapies targeting multiple amino acid transport systems

  • Potential agricultural applications:

    • Creation of transgenic crops expressing AlaE inhibitors

    • Development of sprays containing AlaE-targeting compounds for crop protection

What comparative studies between AlaE from Dickeya zeae and other bacterial pathogens would be most informative?

Comparative studies between D. zeae AlaE and transporters from other pathogens would provide valuable insights through:

  • Structural comparisons:

    • Comparing substrate binding sites and transport mechanisms

    • Identifying unique features of D. zeae AlaE for selective targeting

  • Functional comparisons:

    • Transport kinetics across diverse pathogens

    • Substrate specificity profiles

    • Inhibitor sensitivity patterns

  • Phylogenetic analyses:

    • Evolution of AlaE across bacterial phyla

    • Correlation between AlaE sequence and pathogen host range/lifestyle

  • Regulatory comparisons:

    • Analysis of alaE promoter regions across species

    • Identification of conserved vs. species-specific regulatory mechanisms

Comparative Genomic Data for Dickeya zeae Strains

StrainHostGenome Size (MB)GC Content (%)Sequencing DepthANI Range (%)dDDH Range (%)
PL65Taro4.7499753.6701x94.33-96.2756-68.20
A5410Pineapple4.779253.5558x94.33-96.2756-68.20
Ech586Philodendron~4.75*~53.6*N/A94.33-96.2756-68.20
MS1Banana~4.75*~53.5*N/A94.33-96.2756-68.20
EC1Rice~4.75*~53.5*N/A94.33-96.2756-68.20

*Approximate values based on comparative data in search results

Predicted Protein Characteristics of Recombinant AlaE from Dickeya zeae

ParameterPredicted Value for AlaE
Molecular Weight~30-35 kDa (typical for bacterial amino acid exporters)
Number of Transmembrane Domains8-12 (based on typical membrane transporters)
Oligomeric StateLikely homodimer or homotetramer
Optimal pH for Activity6.5-7.5 (typical for bacterial transporters)
Preferred Detergents for StabilityDDM, LMNG, or UDM
Expected Yield from Recombinant Expression0.5-2 mg per liter of culture

This table provides estimated parameters for AlaE based on typical characteristics of bacterial membrane transporters and amino acid exporters.

What strategies can overcome poor expression of recombinant AlaE?

Researchers facing poor expression of recombinant D. zeae AlaE should consider these methodological interventions:

  • Expression system optimization:

    • Try alternative E. coli strains (C41/C43, specialized for membrane proteins)

    • Test different growth media (TB, 2xYT, minimal media with supplements)

    • Optimize induction parameters (IPTG concentration, induction OD, duration)

  • Construct design modifications:

    • Codon optimization for E. coli expression

    • Use of fusion partners (MBP, SUMO) to enhance solubility

    • Testing different affinity tags and their positions

  • Co-expression strategies:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Consider co-expression with interacting membrane proteins if known

  • Alternative expression hosts:

    • Bacillus subtilis for Gram-positive expression

    • Yeast systems for eukaryotic processing capabilities

How can researchers differentiate between AlaE-mediated transport and passive diffusion in functional assays?

To distinguish AlaE-mediated transport from passive diffusion, researchers should implement these methodological controls:

  • Negative controls:

    • Liposomes without reconstituted protein

    • Denatured AlaE samples (heat-treated)

    • AlaE reconstituted in the presence of specific inhibitors

  • Kinetic analysis:

    • Compare transport rates at varying substrate concentrations

    • Enzymatic transport shows saturation kinetics while diffusion is linear

  • Competitive inhibition:

    • Using structural analogs of L-alanine to demonstrate specificity

    • Non-competitive inhibitors targeting the protein directly

  • Energy coupling:

    • Testing transport in the presence/absence of energy sources

    • Evaluating the effects of protonophores or ionophores

  • Temperature dependence:

    • Comparing Q10 values (rate change per 10°C) between active transport and diffusion

    • Active transport typically shows higher temperature dependence than diffusion

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.