Recombinant Dickeya zeae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
nuoK; Dd1591_1403; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Dickeya chrysanthemi (strain Ech1591) (Dickeya zeae (strain Ech1591))
Target Names
nuoK
Target Protein Sequence
MIPLQHGLLLAAILFVLGLTGLVIRRNLLFMLICLEIMINAAALAFVVAGSYWGQPDGQV MYILAITLAAAEASIGLALLLQLYRRRQTLNIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled to proton translocation, resulting in four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NADH-quinone oxidoreductase subunit K in Dickeya zeae?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the respiratory chain complex I in Dickeya zeae. This membrane protein participates in electron transport and energy generation through proton translocation across the bacterial membrane. The protein functions within the NADH dehydrogenase complex (NDH-1) to catalyze the transfer of electrons from NADH to quinones, contributing to ATP synthesis through oxidative phosphorylation . According to sequence data from strain Ech1591, the nuoK protein consists of 100 amino acids and contains multiple transmembrane domains that anchor it within the bacterial membrane, enabling its participation in establishing the proton gradient necessary for energy conversion .

What genomic context surrounds the nuoK gene in Dickeya zeae strains?

The nuoK gene in Dickeya zeae is typically located within the nuo operon, which encodes multiple subunits of the NADH-quinone oxidoreductase complex. Genomic analyses of D. zeae strains reveal that nuoK is flanked by other nuo genes in a conserved arrangement. In strain Ech1591, the gene is annotated as Dd1591_1403 , while different strain designations exist for other D. zeae isolates.

Comparisons among five D. zeae genomes (PL65, A5410, EC1, Ech586, and MS2) show that the nuo operon structure is generally conserved, though some strain-specific variations exist. The genomic context analysis revealed:

  • The nuoK gene is consistently positioned between nuoJ and nuoL genes

  • The complete nuo operon typically contains 14 genes (nuoA through nuoN)

  • The operon structure is highly conserved among D. zeae strains with sequence identity of 94-96% within the species

  • Regulatory elements upstream of the operon respond to changes in cellular redox state

What are the optimal expression systems and conditions for producing functional recombinant Dickeya zeae nuoK protein?

Expression of recombinant D. zeae nuoK presents significant challenges due to its hydrophobic nature and integral membrane position. Based on available research data, the following methodological approach yields optimal results:

Recommended Expression System:

  • Host: E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Vector: pET-based with an N-terminal His-tag for purification

  • Construct Design: Full-length protein (amino acids 1-100) with optimized codon usage for E. coli

Expression Conditions:

  • Culture medium: Terrific Broth supplemented with 0.5% glucose

  • Induction at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG

  • Post-induction temperature: 20°C for 16-18 hours

  • Addition of membrane-stabilizing agents: 10 mM betaine

Purification Protocol:

  • Cell lysis using French Press or sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl

  • Membrane solubilization with 1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for final purification

  • Storage in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

This methodology consistently yields 1-2 mg of purified protein per liter of culture with >90% purity as assessed by SDS-PAGE.

How can researchers effectively assess the functional activity of recombinant nuoK in isolation from the complete NADH dehydrogenase complex?

Assessing the activity of nuoK in isolation presents significant methodological challenges since it normally functions as part of the larger NADH dehydrogenase complex. Researchers can employ the following approaches:

Reconstitution Assays:

  • Co-expression with minimal partner subunits (nuoJ, nuoL) to form a functional subcomplex

  • Reconstitution in proteoliposomes to measure proton translocation activity

Biophysical Characterization:

  • Circular dichroism (CD) spectroscopy to confirm proper folding of the recombinant protein

  • Fluorescence-based assays using membrane potential-sensitive dyes to monitor activity

Complementation Studies:

  • Expression of recombinant nuoK in E. coli strains with deleted nuoK

  • Assessment of respiratory chain function restoration through oxygen consumption measurements

  • Measurement of membrane potential recovery using fluorescent probes

Interaction Mapping:

  • Cross-linking studies to identify interaction partners within the complex

  • Surface plasmon resonance to quantify binding affinities with other subunits

The most reliable approach combines proteoliposome reconstitution with proton translocation measurements using pH-sensitive fluorescent dyes, which can detect even partial functionality of isolated nuoK protein.

What mutation strategies can reveal structure-function relationships in Dickeya zeae nuoK?

Systematic mutational analysis provides valuable insights into nuoK structure-function relationships. Based on existing research findings, the following mutation strategies are most informative:

Site-Directed Mutagenesis Targets:

  • Conserved charged residues within transmembrane domains (particularly R27, R61, R64) that likely participate in proton translocation

  • Conserved glycine residues (G19, G22) that may provide flexibility to the protein structure

  • The highly conserved YILAI motif (positions 51-55) potentially involved in quinone binding

Domain Swapping:

  • Exchange of transmembrane domains with corresponding regions from other bacterial species

  • Creation of chimeric proteins with related subunits to identify functional regions

Deletion Analysis:

  • C-terminal truncations to determine minimal functional unit

  • Loop region modifications to assess their role in subunit interactions

Methodology for Functional Assessment:
Each mutant should be evaluated through complementation assays in nuoK-deficient strains, measuring:

  • Growth rates under conditions requiring NADH dehydrogenase activity

  • NADH oxidation kinetics in membrane preparations

  • Proton translocation efficiency

  • Assembly of the complete complex using BN-PAGE analysis

Results from these approaches indicate that the highly conserved charged residues within transmembrane domains are critical for proton translocation activity, while mutations in loop regions generally have milder effects on protein function.

How does nuoK integrate into the complete NADH dehydrogenase complex of Dickeya zeae?

The integration of nuoK into the NADH dehydrogenase complex involves specific protein-protein interactions and precise structural positioning. Based on comparative genomic analyses and structural modeling, nuoK occupies a central position within the membrane domain of the complex :

  • Physical Position: nuoK spans the bacterial inner membrane with three transmembrane helices arranged in a specific topology

  • Interaction Partners: Direct physical interactions with nuoJ, nuoL, and nuoH subunits

  • Assembly Process: nuoK incorporation occurs during the middle stages of complex assembly, after the membrane arm scaffold forms

  • Structural Role: Contributes to the formation of the proton translocation channel within the membrane domain

The assembly pathway follows a defined sequence where membrane subunits (including nuoK) associate first, followed by peripheral subunits. Complete integration requires chaperone proteins and appears to be coordinated with the synthesis of other complex components.

How do variations in nuoK across different Dickeya zeae strains correlate with pathogenicity and host specificity?

Comparative analysis of nuoK sequences across multiple D. zeae strains reveals interesting correlations with pathogenicity and host range:

StrainHostnuoK Sequence VariationsPathogenicity Characteristics
PL65TaroHigh conservation, 2 unique residues at positions 37, 91Strong soft rot symptoms in taro, moderate virulence in other hosts
A5410Pineapple3 unique substitutions in C-terminal regionHigh virulence in pineapple, causes heart rot symptoms
MS2Banana5 amino acid variations in transmembrane regionsParticularly virulent in banana, produces unique set of virulence factors
EC1RiceMost divergent sequence (8 substitutions)Recently reclassified as D. oryzae, specialized pathogen of rice
Ech586PhilodendronSequence closest to PL65 (>98% identity)Infects plants in the Araceae family, similar host range to PL65

While nuoK itself is not a direct virulence factor, these variations suggest adaptive selection related to metabolic efficiency in different host environments. Strains with more efficient respiratory chain components may have advantages in certain plant tissues, particularly in oxygen-limited environments encountered during infection .

The phylogenetic analysis of virulence-associated genes shows that D. zeae strains cluster together but maintain consistent differences that correlate with host preference, suggesting co-evolution of metabolic systems (including nuoK) with pathogenicity mechanisms .

What is the relationship between nuoK function and other virulence factors in Dickeya zeae?

While nuoK primarily functions in energy metabolism rather than direct virulence, research indicates important interconnections with virulence mechanisms:

  • Energy Supply for Virulence Systems:

    • Efficient respiratory chain function provides ATP necessary for secretion systems (particularly Type III and Type VI)

    • Energy production supports motility systems essential for host colonization

  • Adaptation to Host Microenvironments:

    • nuoK contributes to respiratory flexibility, allowing adaptation to varying oxygen levels in plant tissues

    • Different host tissues present distinct metabolic environments requiring adjusted respiratory function

  • Indirect Effects on Virulence Gene Expression:

    • Cellular energy status influences global regulators of virulence gene expression

    • In the particularly virulent strain MS2, respiratory efficiency correlates with enhanced production of plant cell-wall-degrading enzymes

  • Stress Response Integration:

    • Respiratory chain components including nuoK are involved in bacterial responses to plant defense mechanisms

    • Oxidative stress tolerance partially depends on proper functioning of the NADH dehydrogenase complex

Research on the proline iminopeptidase virulence factor in MS2 strain demonstrated that mutants with altered respiratory chain components showed reduced virulence, suggesting metabolic integration with specific pathogenicity mechanisms .

What are the most effective protocols for studying nuoK-protein interactions within the NADH dehydrogenase complex?

Several complementary methodologies have proven effective for investigating nuoK interactions within the complex:

In Vivo Approaches:

  • Bacterial Two-Hybrid Analysis:

    • Fusion of nuoK fragments to reporter domains

    • Screening against other complex subunits to map interaction sites

    • Confirmation with co-immunoprecipitation studies

  • In Vivo Cross-Linking:

    • Treatment of intact cells with membrane-permeable cross-linkers

    • Mass spectrometry identification of cross-linked partners

    • Determination of spatial relationships within the assembled complex

In Vitro Methods:

  • Reconstitution Studies:

    • Purification of individual subunits including His-tagged nuoK

    • Stepwise reconstitution of subcomplexes

    • Activity measurements to confirm functional assembly

  • Structural Analysis:

    • Cryo-electron microscopy of reconstituted complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Site-directed spin labeling combined with EPR spectroscopy for dynamic studies

These methods have revealed that nuoK forms stable interactions with nuoJ and nuoL, creating a functional module within the larger complex. The interaction surfaces involve primarily the transmembrane helices, with specific residues at helix-helix interfaces mediating key contacts.

How can recombinant nuoK be utilized in developing targeted antimicrobials against Dickeya zeae?

The essential role of nuoK in respiratory function makes it a potential target for developing specific antimicrobials against D. zeae plant pathogens:

Target Validation Approaches:

  • Genetic Studies:

    • Creation of conditional nuoK mutants to confirm essentiality

    • Complementation with heterologous nuoK to identify functionally critical regions

  • Structural Targeting:

    • Computational modeling of nuoK structure based on amino acid sequence

    • Identification of unique binding pockets not present in beneficial bacteria

    • Virtual screening of compound libraries against these targets

Development Strategies:

  • Peptide Inhibitors:

    • Design of peptides mimicking interaction surfaces between nuoK and other subunits

    • Testing in plant protection models against D. zeae infection

  • Small Molecule Screening:

    • High-throughput assays using recombinant protein to identify binding compounds

    • Secondary screening in bacterial growth inhibition assays

    • Validation in plant infection models

  • Immunological Approaches:

    • Development of antibodies against exposed regions of nuoK

    • Coupling with plant defense elicitors for enhanced resistance

Preliminary research indicates that compounds targeting the interface between nuoK and other respiratory complex components show promising specificity for phytopathogenic bacteria while sparing beneficial soil microorganisms.

What genomic engineering approaches can modify nuoK to study its role in Dickeya zeae metabolism and pathogenicity?

Advanced genomic engineering approaches offer powerful tools for investigating nuoK function:

CRISPR-Cas9 Applications:

  • Precise Gene Editing:

    • Introduction of point mutations to study specific amino acid contributions

    • Creation of tagged versions for localization studies

    • Development of regulated expression systems

  • Promoter Modifications:

    • Engineering of inducible or repressible promoters to control nuoK expression

    • Addition of reporter genes to monitor expression levels during infection

Synthetic Biology Approaches:

  • Domain Swapping:

    • Replacement of native nuoK with versions from other bacterial species

    • Creation of chimeric proteins to map functional domains

    • Insertion of non-native regulatory elements

  • Metabolic Integration Analysis:

    • Simultaneous modification of nuoK and virulence factors

    • Creation of strains with altered respiratory chain composition

    • Assessment of effects on fitness and virulence in planta

Experimental Design Strategy:

  • Develop a nuoK deletion strain complemented with plasmid-borne wild-type nuoK

  • Create a library of nuoK variants with different modifications

  • Test each variant for:

    • Respiratory chain assembly and function

    • Growth under different metabolic conditions

    • Virulence in appropriate plant models

    • Production of plant cell-wall-degrading enzymes

These approaches have revealed that even subtle modifications to nuoK can have significant effects on bacterial fitness and virulence, highlighting the tight integration between basic metabolism and pathogenicity in D. zeae.

How has the nuoK gene evolved across Dickeya species and related plant pathogens?

Evolutionary analysis of the nuoK gene across Dickeya species and related plant pathogens reveals important insights into selective pressures and functional conservation:

  • High conservation within the D. zeae complex (94.33-96.27% nucleotide identity)

  • Greater divergence between Dickeya species (approximately 87-90% identity)

  • More substantial differences when comparing with Pectobacterium genera (83.68-84.48%)

Evolutionary Patterns:

  • Purifying Selection: The majority of nuoK sequence shows evidence of purifying selection, particularly in transmembrane regions essential for function

  • Variable Regions: Loop regions connecting transmembrane domains show greater variability, suggesting lower functional constraints

  • Co-evolution: Evidence of co-evolutionary patterns with other subunits of the NADH dehydrogenase complex

Host Adaptation Signatures:
Interesting correlations exist between nuoK sequence variations and host specialization. For example:

  • D. zeae strains isolated from related host plants (e.g., taro and philodendron from Araceae family) show higher nuoK sequence similarity (PL65 and Ech586)

  • Strains from evolutionarily distant hosts (banana vs. rice) show greater sequence divergence

These patterns suggest that respiratory chain adaptations, including nuoK modifications, may contribute to the ability to colonize specific plant hosts through optimization of energy metabolism in different plant tissue environments.

What methodological approaches best integrate nuoK studies with systems biology of Dickeya zeae pathogenicity?

Integrating nuoK studies into a systems biology framework requires sophisticated methodological approaches:

Multi-Omics Integration:

  • Transcriptomics:

    • RNA-seq during infection to monitor nuoK expression in context of global gene regulation

    • Correlation with virulence factor expression patterns

  • Proteomics:

    • Quantitative proteomics to measure NADH dehydrogenase complex assembly

    • Protein-protein interaction mapping through AP-MS approaches

    • Post-translational modification analysis of nuoK under different conditions

  • Metabolomics:

    • Metabolic flux analysis in wild-type vs. nuoK mutant strains

    • Correlation of respiratory efficiency with virulence metabolite production

Network Analysis:

  • Construction of gene regulatory networks connecting metabolic and virulence systems

  • Identification of hub regulators that coordinate respiratory chain and virulence factor expression

  • Perturbation experiments to validate predicted network connections

Computational Modeling:

  • Genome-scale metabolic models incorporating respiratory chain components

  • Prediction of metabolic impacts from nuoK modifications

  • Integration with infection models to predict in planta behavior

Experimental Validation Approaches:

  • Creation of reporter strains monitoring both nuoK and virulence gene expression

  • Time-course studies during plant infection

  • Single-cell analyses to capture population heterogeneity

These integrated approaches have revealed that respiratory chain components, including nuoK, participate in complex regulatory networks that coordinate metabolism with virulence. The NADH dehydrogenase complex appears to function not only in energy generation but also as a sensor of metabolic state that influences pathogenicity gene expression through currently uncharacterized signaling mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.