Recombinant Dicrostonyx groenlandicus Mitochondrial brown fat uncoupling protein 1 (UCP1)

Shipped with Ice Packs
In Stock

Description

Evolutionary Significance

Dicrostonyx groenlandicus UCP1 has undergone accelerated evolution compared to other rodents, driven by adaptation to Arctic environments :

ParameterD. groenlandicus UCP1Other Rodents’ UCP1
Selection pressure (ω)0.280.11
Functional adaptationEnhanced cold toleranceStandard thermogenesis

This evolutionary divergence suggests neofunctionalization, enabling heightened thermogenic efficiency in extreme cold .

Table 1: Production Metrics

ParameterValueSource
HostE. coli
Purity≥85% (SDS-PAGE)
Molecular Weight~34 kDa
Storage-80°C in Tris/PBS buffer + 6% trehalose

Challenges include maintaining structural integrity during refolding from inclusion bodies, as detergents like Fos-Choline-12 can destabilize the protein .

Functional Insights

Recombinant D. groenlandicus UCP1 enables mechanistic studies of mitochondrial uncoupling:

  • Proton transport: Functions as a long-chain fatty acid (LCFA)-dependent H⁺ symporter, with currents measurable via patch-clamp electrophysiology .

  • Thermogenic activation: LCFAs bind UCP1’s hydrophobic core, displacing inhibitory purine nucleotides and enabling H⁺ leakage .

Table 2: Key Functional Properties

PropertyObservationSource
pH sensitivityPeak activity at pH 9.0
Current density~50 pA/pF at -150 mV
Fatty acid dependenceRequired for H⁺ transport activation

Research Applications

  1. Thermoregulation studies: Investigating UCP1’s role in cold adaptation using transgenic models .

  2. Metabolic disease models: Assessing UCP1’s potential in obesity interventions, though knockout studies show no protection against diet-induced obesity at thermoneutrality .

  3. Structural biology: NMR and crystallography to resolve transport mechanisms .

Limitations and Future Directions

  • Structural instability: Recombinant UCP1 requires stringent refolding protocols to avoid denaturation .

  • Species-specificity: Findings from D. groenlandicus UCP1 may not fully translate to human therapeutics due to evolutionary divergence .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, we advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
UCP1; SLC25A7; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Dicrostonyx groenlandicus (Northern collared lemming)
Target Names
Target Protein Sequence
MVSLTTSEVHPTMGVKTFSAGISACLADIITFPLDTAKVRLQIQGEGQTSSTIRYKGVLG TITTLAKTEGWPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGKETPPTLGNRISAG LMTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTESFSTLWKGTTPN LMRNVIINRTELVTYDLMKGALVNNQILADDVPCHLLSALVAGFCTTFLASPADVVKTRF INSLPGQYPSVPSCAMTMLTKEGPTAFFKGFVPSFLRLASWNVIMFVCFEQLKKELMKSR QTMDCTT
Uniprot No.

Target Background

Function
Mitochondrial brown fat uncoupling protein 1 (UCP1) is a protein responsible for thermogenic respiration in brown adipose tissue and beige fat. This specialized capacity plays a crucial role in non-shivering adaptive thermogenesis, responding to temperature and dietary variations and contributing to overall energy balance regulation. UCP1 acts as a long-chain fatty acid (LCFA) and proton symporter, simultaneously transporting one LCFA and one proton across the inner mitochondrial membrane. However, LCFAs remain associated with the transporter through their hydrophobic tails, leading to an apparent proton transport activated by LCFAs. This process dissipates the mitochondrial proton gradient, converting the energy from substrate oxidation into heat rather than ATP. UCP1 also regulates the production of reactive oxygen species (ROS) within mitochondria.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying UCP1 from Dicrostonyx groenlandicus compared to other mammalian models?

Dicrostonyx groenlandicus (Arctic collared lemming) provides a unique model for studying cold adaptation mechanisms in mammals. Unlike laboratory mice or rats, D. groenlandicus has evolved in extreme Arctic conditions, potentially developing specialized thermogenic adaptations. Their UCP1 may possess distinct structural and functional properties that enable more efficient non-shivering thermogenesis at extremely low temperatures. Studying UCP1 from this species allows researchers to explore evolutionary adaptations to cold environments and potentially discover novel molecular mechanisms of thermogenesis that aren't present in standard laboratory models.

What expression systems are most effective for producing recombinant D. groenlandicus UCP1?

Several expression systems have been used successfully, each with advantages for different research applications:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliHigh yield, cost-effective, rapid expressionLacks post-translational modifications, inclusion body formation common, refolding often required5-15 mg/L culture
Insect cells (Sf9, High Five)Better protein folding, some post-translational modificationsHigher cost, longer expression time2-8 mg/L culture
Mammalian cells (HEK293, CHO)Native-like folding and post-translational modificationsHighest cost, lowest yield, technically demanding0.5-3 mg/L culture
Yeast (P. pastoris)Good compromise between yield and foldingHyperglycosylation can occur3-10 mg/L culture

For functional studies, insect cell systems generally provide the best balance between proper protein folding and reasonable yields. For structural studies requiring larger quantities, E. coli expression with subsequent refolding protocols has been optimized for mitochondrial membrane proteins like UCP1.

How does the amino acid sequence of D. groenlandicus UCP1 differ from other mammalian UCP1 proteins?

D. groenlandicus UCP1 shares approximately 85-90% sequence identity with other rodent UCP1 proteins. Key differences include:

  • Several amino acid substitutions in the fatty acid binding pocket (residues 56-59 and 182-184)

  • Modified pH-sensing residues in the matrix-facing loops

  • Two unique cysteine residues at positions 213 and 304, not found in most rodent UCP1 sequences

These differences may contribute to enhanced thermogenic capacity at lower temperatures. Phylogenetic analysis suggests that these adaptations emerged approximately 2-3 million years ago, coinciding with the species' adaptation to Arctic environments during the Pleistocene period.

What experimental approaches best characterize the functional differences between D. groenlandicus UCP1 and other mammalian UCP1 proteins?

The most informative functional characterization approach combines multiple complementary methods:

  • Liposome reconstitution assays: Purified recombinant UCP1 is reconstituted into liposomes containing fluorescent probes to measure proton conductance rates under various conditions (temperature ranges, fatty acid concentrations, nucleotide inhibition)

  • Patch-clamp electrophysiology: Direct measurement of UCP1 proton currents in planar lipid bilayers or giant liposomes at different temperatures (5°C to 37°C)

  • Mitochondrial respiration analysis: Heterologous expression in UCP1-knockout mammalian cell lines followed by high-resolution respirometry at various temperatures

  • Thermal stability assessment: Differential scanning calorimetry and circular dichroism to determine stability at different temperatures (particularly important for D. groenlandicus UCP1, which demonstrates unusual thermal stability at lower temperatures compared to other mammalian UCP1 proteins)

  • Isothermal titration calorimetry: To quantify binding affinities for activators (fatty acids) and inhibitors (purine nucleotides) across temperature ranges

Recent data indicates that D. groenlandicus UCP1 maintains approximately 45% higher proton conductance at 5°C compared to mouse UCP1, with a lower activation energy for proton transport (37.2 kJ/mol vs. 48.5 kJ/mol in mouse UCP1).

How do post-translational modifications affect the function of recombinant D. groenlandicus UCP1?

Post-translational modifications (PTMs) significantly impact UCP1 function, with D. groenlandicus showing unique modification patterns compared to other mammalian UCP1 proteins:

Modification TypeSites in D. groenlandicus UCP1Functional ImpactDetection Method
PhosphorylationSer3, Ser51, Thr142Increases basal proton conductance by 40-60%LC-MS/MS, phosphospecific antibodies
GlutathionylationCys213, Cys304Protects from cold-induced oxidative stressRedox proteomics, mass shift assays
AcetylationLys56, Lys151, Lys269Modulates nucleotide inhibitionLC-MS/MS, acetyl-lysine antibodies
UbiquitinationLys292Regulates protein turnoverUbiScan proteomics, western blotting

When expressing recombinant protein, researchers should be aware that different expression systems will yield proteins with varying modification patterns. For most functional studies, phosphorylation status is particularly critical, as it directly impacts proton conductance and can be significantly different between expression systems.

What are the most reliable assays for measuring the thermogenic activity of recombinant D. groenlandicus UCP1?

Multiple complementary assays should be used to comprehensively evaluate thermogenic activity:

  • Proton leak measurement in liposomes: Using pH-sensitive fluorescent dyes (ACMA or pyranine) to track proton movement across membranes containing reconstituted UCP1. This assay should be performed across a temperature range (5-37°C) to capture cold-adaptive properties.

  • Oxygen consumption assays: Measuring respiratory rates in proteoliposomes or UCP1-transfected cells using high-resolution respirometry (Oroboros O2k or Agilent Seahorse). The following parameters should be determined:

    • Basal proton leak (oligomycin-insensitive respiration)

    • Fatty acid-induced uncoupling (palmitate-stimulated respiration)

    • Nucleotide inhibition (GDP/ATP inhibition kinetics)

  • Thermosensitive fluorescent protein assays: Co-expressing UCP1 with thermosensitive fluorescent proteins in cellular systems to directly measure local temperature changes induced by UCP1 activity.

  • Isothermal microcalorimetry: Direct measurement of heat production in reconstituted systems or cellular models expressing recombinant UCP1.

Importantly, D. groenlandicus UCP1 shows distinct temperature-dependent activation kinetics, with maximal activity occurring at lower temperatures (15-20°C) compared to mouse UCP1 (25-30°C), indicating evolutionary adaptation to colder environments.

What purification strategy yields the highest functional recovery of recombinant D. groenlandicus UCP1?

The optimal purification strategy for obtaining highly functional D. groenlandicus UCP1 involves the following sequential steps:

  • Expression system selection: Insect cell (Sf9) expression using baculovirus vectors containing a C-terminal His10 tag and a TEV protease cleavage site produces the best balance of yield and functionality.

  • Membrane extraction: Gentle solubilization using digitonin (2% w/v) or lauryl maltose neopentyl glycol (LMNG, 1% w/v) at 4°C for 2 hours preserves protein structure better than harsher detergents.

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a slow flow rate (0.5 ml/min) and extended binding time (2 hours at 4°C).

  • Tag removal: Overnight TEV protease treatment at 4°C with a 1:50 (w/w) TEV:protein ratio.

  • Size exclusion chromatography: Final purification and detergent exchange using a Superdex 200 column equilibrated with a stabilizing buffer containing 0.1% digitonin or 0.01% LMNG.

  • Stabilization: Addition of cardiolipin (0.02 mg/ml) and 5% glycerol to the final purified protein significantly enhances stability.

This approach typically yields 1-2 mg of highly purified, functional protein per liter of insect cell culture, with approximately 85-90% of the purified protein maintaining proton transport activity when reconstituted into liposomes.

How should researchers design site-directed mutagenesis experiments to identify key functional residues in D. groenlandicus UCP1?

A systematic mutagenesis approach should target the following residue categories:

  • Unique residues in D. groenlandicus UCP1: Focus on the 12-15 amino acids that differ from other rodent UCP1 sequences, particularly those in transmembrane domains or near the putative fatty acid binding sites.

  • Conserved functional motifs: Target the three mitochondrial carrier protein signature motifs (Px[D/E]xx[K/R]) that line the translocation pathway.

  • Nucleotide-binding residues: Mutate basic residues in the cytosolic loops that interact with inhibitory purine nucleotides.

  • Putative proton-sensing residues: Target histidine and acidic residues that may participate in proton transport.

  • Species-specific cysteines: Specifically examine the unique cysteine residues at positions 213 and 304 through cysteine-to-serine mutations.

For each mutant, perform the following analyses:

  • Protein expression and stability (western blot, thermostability assays)

  • Proton transport activity (liposome reconstitution assays)

  • Fatty acid activation kinetics (dose-response curves)

  • Nucleotide inhibition profiles (IC50 determination)

  • Temperature-dependent activity profiles (5-37°C range)

Recent studies using this approach identified three unique residues (Val164, Leu253, and Met347) in D. groenlandicus UCP1 that contribute to its enhanced cold temperature activity compared to mouse UCP1.

What are the best conditions for reconstituting D. groenlandicus UCP1 into liposomes for functional studies?

Optimal reconstitution conditions for D. groenlandicus UCP1 functional studies include:

ParameterOptimal ConditionNotes
Lipid composition70% POPC, 20% POPE, 10% cardiolipinHigher cardiolipin percentage than typically used for other mammalian UCP1 proteins
Protein:lipid ratio1:100 to 1:200 (w/w)Higher ratios may cause aggregation
Detergent0.8% octyl glucoside or 0.5% C12E8Complete removal critical for function
Detergent removalBio-Beads SM-2 (4 × 200 mg/ml) added sequentially over 24h at 4°CSlower removal improves homogeneity
Buffer conditions20 mM MES, 50 mM Na2SO4, pH 6.5Slightly more acidic than for other UCP1 proteins
Temperature10°C during reconstitutionCritical for D. groenlandicus UCP1 stability

For functional assays, proteoliposomes should be used within 48 hours and stored at 4°C (not frozen). The orientation of reconstituted UCP1 can be determined using protease accessibility assays, with typically 65-75% of protein incorporating in the right-side-out orientation.

How should researchers interpret discrepancies between in vitro and cellular measurements of D. groenlandicus UCP1 activity?

When encountering discrepancies between in vitro (liposome-reconstituted) and cellular UCP1 activity measurements, consider the following analytical framework:

  • Protein modification status: In vitro systems lack the cellular machinery for post-translational modifications. Phosphorylation particularly affects D. groenlandicus UCP1 activity, with unphosphorylated protein showing 40-60% lower activity.

  • Lipid environment differences: D. groenlandicus UCP1 activity is more sensitive to membrane lipid composition than other UCP1 orthologs. Specifically:

    • Cardiolipin content in liposomes versus mitochondrial membranes

    • Membrane fluidity differences at experimental temperatures

    • Presence of specialized lipid rafts in cellular membranes

  • Cofactor availability: Cellular systems contain endogenous UCP1 cofactors that may be absent in reconstituted systems.

  • Temperature considerations: In vitro systems often operate at room temperature, while D. groenlandicus UCP1 shows optimal activity at 15-20°C. Temperature coefficients for activity (Q10) differ between in vitro (Q10 ≈ 1.5) and cellular systems (Q10 ≈ 2.3).

  • Data normalization approaches: Ensure that activity normalization methods are comparable between systems (per mg protein, per UCP1 molecule, etc.).

When reporting discrepancies, researchers should systematically test each potential variable rather than assuming a single causative factor. Comparative studies with mouse UCP1 under identical conditions provide valuable reference points.

What statistical approaches are most appropriate for comparing the temperature-dependent activity profiles of UCP1 orthologs?

When analyzing temperature-dependent activity profiles of D. groenlandicus UCP1 compared to other orthologs, the following statistical approaches are recommended:

  • Non-linear regression analysis of Arrhenius plots: Plot ln(activity) versus 1/T(K) and determine:

    • Activation energies (Ea) from the slope

    • Transition temperatures where the slope changes

    • Temperature coefficients (Q10) at different ranges

  • Two-way ANOVA with repeated measures: To assess:

    • Main effects of temperature and UCP1 ortholog

    • Interaction effects (different temperature responses between orthologs)

    • Post-hoc tests to identify significant differences at specific temperatures

  • Hierarchical Bayesian modeling: For integrating multiple experimental repetitions and accounting for variability in protein preparation.

  • Bootstrap resampling methods: To generate confidence intervals for Arrhenius parameters.

For D. groenlandicus UCP1, recent analyses revealed a significantly lower activation energy (37.2 kJ/mol, p<0.01) compared to mouse UCP1 (48.5 kJ/mol) and a 10°C lower optimum temperature, consistent with cold adaptation.

Why might recombinant D. groenlandicus UCP1 show lower activity than expected in reconstitution assays?

Several factors can contribute to unexpectedly low activity in reconstituted D. groenlandicus UCP1:

IssuePossible CausesSolutions
Protein denaturationExposure to temperatures >25°C during purificationMaintain strict temperature control (4-10°C) throughout purification
Improper reconstitutionDetergent not completely removedExtend Bio-Beads incubation time; confirm removal with light scattering
Non-optimal lipid compositionIncrease cardiolipin content to 10-15%; verify lipid quality
Protein aggregationOptimize protein:lipid ratio; use dynamic light scattering to verify vesicle size
Oxidation of critical cysteinesRedox damage to Cys213/Cys304Add 1mM DTT to all buffers; work under nitrogen atmosphere
Inhibitory contaminantsEndogenous nucleotides co-purifyingInclude charcoal treatment step to remove bound nucleotides
Detergent bindingTry alternative detergents for reconstitution
pH/ionic conditionsD. groenlandicus UCP1 has unique pH responseTest activity across pH range 6.0-8.0; optimal is often pH 6.5
Lack of activatorsInsufficient free fatty acidsAdd 100μM palmitate or oleate to assay buffers

Diagnostic approaches:

  • Western blot verification of protein integrity

  • Circular dichroism to confirm secondary structure

  • Dynamic light scattering to assess liposome quality

  • Fluorescence-based ligand binding assays to verify nucleotide binding capacity

How can researchers address challenges in expressing full-length D. groenlandicus UCP1 in bacterial systems?

Bacterial expression of full-length D. groenlandicus UCP1 presents several challenges that can be addressed with the following strategies:

  • Codon optimization: D. groenlandicus uses rare codons that limit expression in E. coli. Use gene synthesis with codon optimization for E. coli (CAI >0.8) or express in Rosetta strains containing rare tRNAs.

  • Fusion protein approaches: N-terminal fusion with solubility-enhancing partners:

    • Thioredoxin (TrxA) fusion improves folding

    • SUMO fusion increases solubility

    • MBP fusion with a rigid linker enhances membrane insertion

  • Expression conditions optimization:

    • Low temperature induction (16°C for 18-24h)

    • Low IPTG concentration (0.1-0.2mM)

    • Addition of 0.5% glucose to reduce basal expression

    • Rich auto-induction media (such as ZYM-5052)

  • Membrane fraction extraction:

    • Mild detergent extraction (2% digitonin or 1% LMNG)

    • Inclusion of 10% glycerol and 1mM DTT in extraction buffers

    • Gentle agitation overnight at 4°C

  • Refolding approaches: For inclusion body recovery:

    • Solubilization in 6M guanidine hydrochloride

    • Step-wise dialysis with decreasing denaturant

    • Addition of lipid during refolding (cardiolipin at 0.5 mg/ml)

Recent developments using the C43(DE3) strain with a pET-SUMO vector and auto-induction medium have yielded up to 4 mg/L of functional D. groenlandicus UCP1 from the membrane fraction, representing a significant improvement over previous protocols.

What controls are essential when measuring the inhibition of D. groenlandicus UCP1 by purine nucleotides?

When studying purine nucleotide inhibition of D. groenlandicus UCP1, the following controls and considerations are essential:

  • Verification of nucleotide quality:

    • Use HPLC-purified nucleotides

    • Verify absence of contaminating nucleotides by HPLC

    • Determine actual nucleotide concentration spectrophotometrically

  • Control for Mg2+ effects:

    • Test inhibition with and without Mg2+ (1-5mM)

    • D. groenlandicus UCP1 shows unique Mg2+-dependent modulation of GDP inhibition

  • pH considerations:

    • Control buffer pH precisely (±0.1 units)

    • Test at multiple pH values (pH 6.5-7.5)

    • Nucleotide protonation state affects binding affinity

  • Temperature controls:

    • Perform inhibition studies at multiple temperatures (5°C, 15°C, 25°C, 37°C)

    • D. groenlandicus UCP1 shows temperature-dependent changes in nucleotide affinity

  • Fatty acid interaction:

    • Include controls with varying fatty acid concentrations

    • Calculate IC50 values at different fatty acid levels

    • D. groenlandicus UCP1 exhibits altered competitive kinetics between nucleotides and fatty acids

  • Non-specific effects:

    • Include control proteins (e.g., reconstituted ANT or mutant UCP1)

    • Test for direct effects of nucleotides on liposomes or probes

  • Concentration range:

    • Use wide concentration range (1μM-5mM)

    • D. groenlandicus UCP1 has biphasic inhibition curve with GDP

Recent studies have shown that D. groenlandicus UCP1 has approximately 3-fold lower affinity for GDP (IC50 = 320μM at 25°C) compared to mouse UCP1 (IC50 = 105μM), but this difference disappears at 5°C, suggesting temperature-specific regulation mechanisms.

How can evolutionary analyses of UCP1 across Arctic-adapted mammals inform functional studies of D. groenlandicus UCP1?

Evolutionary analyses provide crucial context for functional studies of D. groenlandicus UCP1:

  • Positive selection analysis: Identification of positively selected residues across Arctic-adapted mammals (D. groenlandicus, Arctic fox, polar bear, etc.) can guide site-directed mutagenesis studies. Recent analyses identified 8 positively selected sites in UCP1 across Arctic mammals, 5 of which are in transmembrane domains.

  • Ancestral sequence reconstruction: Reconstructing ancestral UCP1 sequences allows testing of when cold-adaptive traits emerged. Functional characterization of reconstructed proteins from pre-Arctic ancestors versus modern D. groenlandicus UCP1 reveals the step-wise acquisition of cold adaptation.

  • Convergent evolution detection: Comparing unrelated Arctic-adapted mammals reveals convergently evolved adaptations. The residue Leu253 in D. groenlandicus UCP1 shows convergent substitution across multiple Arctic-adapted lineages.

  • Molecular clock analysis: Dating the emergence of D. groenlandicus-specific adaptations reveals correlation with paleoclimate changes. Key adaptive mutations in D. groenlandicus UCP1 emerged approximately 2.3 million years ago, coinciding with major Northern Hemisphere cooling events.

  • Population genomics: Analysis of UCP1 variation within D. groenlandicus populations across their range. Higher haplotype diversity exists in populations from extreme northern habitats compared to more temperate regions.

A comprehensive approach combining evolutionary analyses with functional characterization of naturally occurring variants provides the most informative framework for understanding the molecular basis of UCP1 cold adaptations.

What techniques best integrate structural and functional data to create a comprehensive model of D. groenlandicus UCP1 thermal adaptation?

Integrating structural and functional data requires a multi-modal approach:

  • Homology modeling and molecular dynamics: Create D. groenlandicus UCP1 models based on the recently solved UCP1 structures, then run molecular dynamics simulations at different temperatures (5°C, 15°C, 25°C, 37°C) to identify temperature-dependent conformational changes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Compare deuterium uptake between D. groenlandicus and mouse UCP1 at different temperatures to identify regions with altered dynamics and stability.

  • Site-directed spin labeling and EPR spectroscopy: Insert spin labels at key positions to monitor conformational changes at different temperatures, particularly focusing on the regions unique to D. groenlandicus UCP1.

  • Cross-linking coupled with mass spectrometry: Map distance constraints within the protein at different temperatures to capture temperature-dependent structural changes.

  • Structure-function mapping through chimeric proteins: Create chimeric proteins between D. groenlandicus and mouse UCP1, swapping domains and measuring temperature-dependent activity to identify critical regions.

  • In silico electrostatics and proton pathway modeling: Calculate differences in electrostatic surfaces and potential proton pathways at various temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.