Recombinant Dictyoglomus thermophilum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; DICTH_0757; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Target Names
htpX
Target Protein Sequence
MKPFTFYEAIEANKRKTWIIIFVISILLFLVCYAIVSYFELGEFGILVAFLMVFFVNYYA YKNSDEIILKYSGVREPTKEEFPYLLNVVEGLSIAAGIPTPKIYVMDDPSPNAFATGKDP KSGVVVVTKGLLDLLDRLELEGVIAHEISHIKNYDVRLQTVAAVMVGLIVILGDSLKRSF YYSRRRRDKDENILGIVSLVIAILAPFLATLLKFALSRQREYMADANAAMLTRYPEGLAS ALEKISKNFQPVKRANTMTAPLYIVNPLKGGMSNLFSTHPPIEDRIRRLRMMGERWKLLD KEG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Dictyoglomus thermophilum and why is the HtpX homolog of interest to researchers?

Dictyoglomus thermophilum is an extremely thermophilic bacterium that thrives at temperatures around 80°C. The organism is of significant interest because its enzymes, including the Protease HtpX homolog, exhibit exceptional thermostability, making them valuable for both fundamental research into protein stability mechanisms and biotechnological applications requiring enzymes that function at high temperatures . The HtpX homolog specifically belongs to a family of membrane-bound zinc metalloproteases (EC 3.4.24.-) that typically function in protein quality control pathways, particularly for membrane proteins .

How does the thermostability of D. thermophilum HtpX compare with homologs from mesophilic organisms?

While direct comparative studies specific to HtpX are not detailed in the available literature, research on other enzymes from D. thermophilum, such as XynB (a β-1,4-xylanase), has revealed structural adaptations that contribute to thermostability. These include "a greater proportion of polar surface and a slightly extended C-terminus that, combined with the extension of beta-strand A5, gives additional hydrogen bonding and hydrophobic packing" . Similar structural adaptations likely contribute to HtpX thermostability, potentially allowing it to maintain structural integrity and catalytic function at temperatures that would denature homologous proteins from mesophilic organisms. Experimental approaches to quantify this difference would involve comparative thermal denaturation studies using techniques such as differential scanning calorimetry or activity assays at increasing temperatures.

What expression systems are most suitable for recombinant production of D. thermophilum HtpX?

Based on studies with other thermostable enzymes from D. thermophilum, Escherichia coli expression systems have proven effective for recombinant protein production . Specifically, E. coli BL21(DE3) has been successfully employed as a host strain for D. thermophilum enzymes. For optimal expression, researchers have utilized auto-induction methods, where cultures are initially grown at 37°C until reaching an OD600 of 0.8-1.0, followed by protein expression at 30°C for 16 hours . This approach may be adapted for HtpX expression, though optimization may be necessary given its membrane protein nature.

For larger-scale production, bioreactor-based expression has been demonstrated for other D. thermophilum enzymes, with parameters including:

  • Temperature: 37°C for growth phase, reduced to 30°C for expression phase

  • pH: Maintained at 7.0 ± 0.1 using NH4OH

  • Dissolved oxygen: Controlled at 40% through cascade settings

  • Agitation: 300-800 rpm

What challenges are associated with membrane protein expression, and how can they be addressed for D. thermophilum HtpX?

Expressing membrane proteins like D. thermophilum HtpX presents several challenges:

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membrane integrity.

  • Protein misfolding: Improper folding or membrane integration can lead to inclusion body formation.

  • Low yields: Membrane proteins typically express at lower levels than soluble proteins.

Methodological approaches to address these challenges include:

  • Strain selection: Using specialized E. coli strains like C41(DE3) or C43(DE3) that are more tolerant to membrane protein overexpression.

  • Expression optimization: Testing different induction temperatures (typically lower temperatures favor proper folding), inducer concentrations, and expression durations.

  • Fusion strategies: Incorporating solubility-enhancing tags or fusion partners.

  • Membrane mimetics: Including appropriate detergents or lipids during extraction and purification to maintain protein structure and function.

What purification protocol would yield highly pure and active D. thermophilum HtpX?

A comprehensive purification strategy for D. thermophilum HtpX should account for both its membrane-bound nature and thermostability:

Step 1: Cell Lysis and Membrane Extraction

  • Mechanical disruption (e.g., sonication or high-pressure homogenization)

  • Differential centrifugation to isolate membrane fractions

  • Solubilization using appropriate detergents (e.g., DDM, LDAO, or C12E8)

Step 2: Heat Treatment

  • Exploiting the thermostability of D. thermophilum proteins by heating the extract (e.g., 60-70°C for 10-15 minutes)

  • Centrifugation to remove precipitated host proteins

Step 3: Chromatographic Purification

  • Affinity chromatography if using tagged protein

  • Ion exchange chromatography based on predicted isoelectric point

  • Size exclusion chromatography as a final polishing step

Step 4: Concentration and Storage

  • Concentration using appropriate molecular weight cutoff filters

  • Storage in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

What experimental approaches can determine the optimal conditions for D. thermophilum HtpX activity?

A systematic characterization of D. thermophilum HtpX activity would involve:

Temperature Optimization:

  • Prepare a standard enzymatic assay with appropriate substrate

  • Conduct assays across a temperature range (e.g., 30-95°C in 5-10°C increments)

  • Plot relative activity vs. temperature to identify temperature optimum

pH Optimization:

  • Prepare buffers covering a wide pH range (e.g., pH 4-10)

  • Perform activity assays at constant temperature across the pH range

  • Plot relative activity vs. pH to identify pH optimum

Metal Ion Dependency:

  • Test activity in the presence of various metal ions (e.g., Zn²⁺, Ca²⁺, Mg²⁺)

  • Include metal chelators (e.g., EDTA) to confirm metal dependency

  • Determine optimal metal ion concentration

Thermostability Assessment:

  • Pre-incubate the enzyme at various temperatures for defined time periods

  • Measure residual activity under standard conditions

  • Calculate half-life at different temperatures

What are the most effective methods for measuring protease activity of D. thermophilum HtpX?

Several methodological approaches can be employed to quantify HtpX protease activity:

Fluorogenic Peptide Substrates:

  • Select peptides containing a fluorophore and quencher separated by a potential cleavage sequence

  • Measure fluorescence increase as the peptide is cleaved

  • Calculate initial reaction rates at different substrate concentrations

  • Determine kinetic parameters (Km, kcat, etc.)

SDS-PAGE-Based Assays:

  • Incubate HtpX with potential protein substrates

  • Analyze cleavage patterns using SDS-PAGE

  • Quantify band intensities to determine substrate preference and cleavage efficiency

Zymography:

  • Prepare non-reducing SDS-PAGE gels containing potential substrates

  • After electrophoresis, renature the enzyme and allow proteolysis

  • Visualize zones of clearing indicating proteolytic activity

How can researchers distinguish between specific D. thermophilum HtpX activity and non-specific proteolysis in experimental systems?

Differentiation between specific HtpX activity and background proteolysis requires careful experimental design:

Control Experiments:

  • Include catalytically inactive enzyme (created through site-directed mutagenesis of putative active site residues)

  • Compare activity with and without specific metalloprotease inhibitors

  • Use substrate specificity profiling to establish cleavage preferences

Statistical Validation:

  • Perform all experiments in at least triplicate

  • Apply appropriate statistical tests to determine significance

  • Establish dose-dependency of both substrate and enzyme concentration effects

Substrate Specificity Analysis:

  • Test activity against a diverse peptide library

  • Identify consensus cleavage motifs

  • Confirm specificity through competition assays with predicted optimal substrates

How can structural biology techniques be applied to investigate the thermostability mechanisms of D. thermophilum HtpX?

Understanding the structural basis of HtpX thermostability can be approached through multiple complementary techniques:

X-ray Crystallography:

  • Express, purify, and crystallize D. thermophilum HtpX (challenging for membrane proteins)

  • Collect diffraction data and solve the structure

  • Analyze structural features associated with thermostability

  • Compare with mesophilic homologs to identify thermostability-enhancing elements

Cryo-Electron Microscopy:

  • Prepare HtpX samples in appropriate membrane mimetics

  • Collect high-resolution cryo-EM data

  • Generate 3D reconstructions to elucidate structural details

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Expose the protein to D2O at different temperatures

  • Monitor deuterium incorporation rates

  • Identify regions with differential flexibility/rigidity compared to mesophilic homologs

Molecular Dynamics Simulations:

  • Generate molecular models of D. thermophilum HtpX

  • Simulate protein behavior at different temperatures

  • Identify stabilizing interactions that persist at elevated temperatures

What role might D. thermophilum HtpX play in membrane protein quality control under extreme temperature conditions?

The potential role of HtpX in membrane proteostasis at high temperatures represents an important research direction:

Substrate Identification:

  • Perform co-immunoprecipitation experiments to identify interacting proteins

  • Use proteomic approaches to compare membrane protein profiles in wild-type vs. HtpX-deficient strains

  • Develop in vitro degradation assays with potential substrate membrane proteins

Stress Response Integration:

  • Analyze HtpX expression levels under various stress conditions

  • Determine whether HtpX activity is regulated post-translationally

  • Investigate potential interactions with other components of protein quality control machinery

Functional Complementation Studies:

  • Express D. thermophilum HtpX in mesophilic organisms lacking native HtpX

  • Test whether the thermophilic enzyme can function at lower temperatures

  • Evaluate its ability to complement phenotypes associated with HtpX deficiency

How can researchers engineer D. thermophilum HtpX for enhanced catalytic properties or modified substrate specificity?

Protein engineering approaches to modify HtpX properties include:

Rational Design:

  • Identify catalytic residues through sequence alignment and structural prediction

  • Design mutations to alter substrate specificity or catalytic efficiency

  • Test engineered variants using standardized activity assays

Directed Evolution:

  • Create a library of HtpX variants through random mutagenesis

  • Develop high-throughput screening or selection methods

  • Identify variants with desired properties

  • Characterize beneficial mutations and potentially combine them

Domain Swapping:

  • Identify functional domains through bioinformatic analysis

  • Create chimeric proteins combining domains from HtpX homologs

  • Test for altered substrate specificity or improved properties

What strategies can overcome expression and solubility issues with recombinant D. thermophilum HtpX?

Researchers encountering expression challenges can implement the following methodological approaches:

Optimizing Expression Conditions:

  • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), etc.)

  • Vary induction parameters (temperature, inducer concentration, duration)

  • Explore auto-induction methods that have proven successful for other D. thermophilum proteins

Fusion Tag Selection:

  • Test various solubility-enhancing tags (MBP, SUMO, thioredoxin)

  • Include appropriate linkers and protease cleavage sites

  • Validate that fusion doesn't compromise activity

Scale-up Strategies:

  • Implement fed-batch cultivation in bioreactors

  • Optimize feeding strategies to maximize biomass and protein production

  • Monitor dissolved oxygen and pH throughout cultivation

How can researchers maintain D. thermophilum HtpX stability during purification and storage?

Preserving protein stability throughout experimental workflows requires careful consideration:

Buffer Optimization:

  • Test various buffer compositions (HEPES, Tris, phosphate)

  • Include stabilizing additives (glycerol, reducing agents)

  • Optimize pH based on stability rather than just activity

Storage Conditions:

  • Store at -20°C for routine use, or -80°C for extended storage

  • Include 50% glycerol to prevent freezing damage

  • Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • For working stocks, maintain at 4°C for up to one week

Activity Preservation:

  • Add metal ions (likely Zn²⁺) to maintain active site integrity

  • Include appropriate protease inhibitors to prevent autoproteolysis

  • Monitor activity over time under different storage conditions

What experimental controls are essential when characterizing D. thermophilum HtpX activity and specificity?

Rigorous experimental design requires appropriate controls:

Negative Controls:

  • Heat-inactivated enzyme preparations

  • Reactions with specific metalloprotease inhibitors

  • Catalytically inactive mutants (if available)

Positive Controls:

  • Commercial proteases with known activity

  • Well-characterized substrates with established cleavage patterns

  • Internal standards for quantitative comparisons

Experimental Validation:

  • Perform all assays in at least triplicate

  • Include substrate-only and enzyme-only controls

  • Ensure linear reaction conditions when determining kinetic parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.