Recombinant Dictyoglomus turgidum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

The recombinant HtpX homolog is produced in E. coli systems for research and industrial applications:

Expression and Purification

ParameterDetail
Expression VectorpRham with N-terminal His tag
InductionRhamnose-induced
PurificationAffinity chromatography via His tag
Yield50 µg aliquots (commercial kits)

Biotechnological Relevance

  • Enzyme Engineering: Serves as a model for studying thermostable proteases .

  • Industrial Processes: Potential use in biomass degradation due to D. turgidum’s enzymatic repertoire .

  • Research Tool: Utilized in ELISA kits for protein interaction studies .

Comparative Analysis with Homologs

The HtpX family exhibits conserved features across bacteria and archaea:

OrganismFunctionKey Difference
E. coli HtpXDegrades misfolded membrane proteins Periplasmic orientation, self-cleaving
S. maltophilia HtpXAG resistance via stress response Cytoplasmic protease activity
D. turgidum HtpXHypothesized structural stabilization Thermostable, full-length expression

Future Research Directions

  • Activity Assays: Adapt E. coli-based in vivo protease assays to characterize D. turgidum HtpX.

  • Structural Studies: Resolve 3D structures to elucidate zinc-binding motifs and substrate interactions.

  • Metabolic Role: Investigate its contribution to D. turgidum’s polysaccharide degradation pathway .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly include your request in the order notes. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. To facilitate long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type in mind, please inform us so we can prioritize the development of your specified tag.
Synonyms
htpX; Dtur_0907; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Dictyoglomus turgidum (strain Z-1310 / DSM 6724)
Target Names
htpX
Target Protein Sequence
MKPFTFYEAIESNKRKTWFIVFIIYFLLFFVCYAVVSYFELGEIGIIIAFLIVLFTNYYA YQKSNEIILNYSGVREPTREEYPYLLNVVEGLSIAAGIPTPKIYIMDDPSPNAFATGKDP QNSVVVVTKGLLDILNRTELEGVIAHEISHIKNYDVRLQTIAAVMVGLIVILGDGLKRSF YYSKRRRDKDENILGIVSLIIAILAPFLATLLRFALSRQREYMADASAAMLTRYPEGLAS ALEKIAKNFQPIKRANVMTAPLYIVNPLSSNAVSKLFSTHPPIEERIRRLRMMGERWKML DKEG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Dictyoglomus turgidum and its taxonomic significance?

Dictyoglomus turgidum is a chemoorganotrophic, extremely thermophilic, Gram-negative, strictly anaerobic bacterium. It forms part of the Dictyoglomi phylum alongside Dictyoglomus thermophilum. These organisms are distantly related to Caldicellulosiruptor species. D. turgidum has significant genomic adaptations that allow it to thrive in extreme conditions, with optimal growth occurring at approximately 72°C .

Interestingly, despite its thermophilic nature, D. turgidum has an unusually low G+C content of 39.9%, which may account for the presence of reverse gyrase, an enzyme typically associated with hyperthermophiles . This bacterium represents an important model organism for studying extremophile adaptations and evolutionary relationships in prokaryotic taxonomy.

What is the HtpX protease and what is its biological function?

The HtpX protease is a membrane-bound zinc metalloprotease that plays a critical role in proteolytic quality control of membrane proteins. Based on studies of its homolog in Escherichia coli, HtpX participates in the elimination of malfolded and/or misassembled membrane proteins that could potentially disrupt membrane structure and function .

HtpX belongs to the M48 family of zinc metalloproteinases and is localized in the cytoplasmic membrane. It functions as part of the cell's protein quality control system, working in conjunction with other proteases such as FtsH (an ATP-dependent protease) to maintain membrane protein homeostasis . This activity is particularly important under stress conditions where protein misfolding may occur more frequently, helping to safeguard normal cellular activities by preventing the accumulation of potentially harmful misfolded proteins.

What is known about the structure of Dictyoglomus turgidum HtpX protease?

The Dictyoglomus turgidum Protease HtpX homolog is a membrane protein with multiple hydrophobic regions that likely function as transmembrane segments. Based on the amino acid sequence provided in the product information, the protein consists of 304 amino acids .

What are the recommended methods for purifying recombinant HtpX protease?

Purification of recombinant HtpX protease presents unique challenges due to its membrane-bound nature and tendency for self-degradation. Based on studies with E. coli HtpX, the following methodological approach is recommended:

  • Purification under denaturing conditions: Due to HtpX's self-degradation upon cell disruption or membrane solubilization, purification under denaturing conditions is recommended to maintain protein integrity .

  • Refolding process: After purification, carefully refold the protein in the presence of a zinc chelator to prevent premature activation and self-cleavage .

  • His-tag purification: Utilize histidine tagging for affinity purification. Standard methods for His-tagged proteins as described by Spriestersbach et al. (2015) have proven effective for HtpX homologs .

  • Controlled zinc addition: Only add Zn²⁺ when ready to assess enzymatic activity, as zinc supplementation will activate the enzyme and may initiate self-cleavage .

This purification approach balances the need to obtain adequate quantities of protein while preserving its native structure and potential for enzymatic activity after refolding.

How can researchers establish an effective assay for measuring HtpX protease activity?

Establishing a reliable assay for HtpX protease activity requires careful consideration of its membrane-associated nature and specific substrate preferences. Based on research with E. coli HtpX, a comprehensive approach would include:

  • In vivo model substrate system: Develop or utilize a model substrate that allows for sensitive detection of protease activity. Recent research has established semiquantitative and convenient in vivo protease activity assay systems for HtpX that enable detection of differential protease activities of various HtpX mutants .

  • Substrate selection: For in vitro assays, both general protease substrates and specific membrane protein substrates should be tested:

    • Casein has been effectively used as a general substrate for confirming proteolytic activity

    • Solubilized membrane proteins such as SecY have demonstrated susceptibility to HtpX cleavage

  • Activity conditions optimization:

    • Ensure proper Zn²⁺ supplementation as HtpX is a zinc-dependent protease

    • Consider temperature optimization, especially for thermophilic D. turgidum HtpX, which may have different temperature optima than mesophilic homologs

    • Control detergent conditions when working with solubilized enzyme to maintain proper folding

  • Detection methods:

    • Western blotting with antibodies against substrates or tags

    • Fluorogenic peptide substrates for quantitative measurements

    • Reporter protein fusions that produce measurable signals upon cleavage

For researchers new to HtpX studies, beginning with established model substrate systems before attempting to identify novel physiological substrates is highly recommended.

What expression systems are most suitable for producing functional recombinant D. turgidum HtpX?

Selecting an appropriate expression system for D. turgidum HtpX requires balancing several factors including protein solubility, proper folding, and the thermophilic nature of the source organism. Based on available information and related protein expression studies:

  • E. coli expression systems:

    • The pRham vector system with rhamnose-inducible promoter has been successfully used for expression of other D. turgidum proteins and may be suitable for HtpX

    • N-terminal histidine tagging facilitates purification while potentially minimizing interference with membrane insertion

    • Expression optimization may require testing different E. coli strains (e.g., BL21(DE3), C41(DE3), or C43(DE3)) specialized for membrane protein expression

  • Induction conditions:

    • IPTG (1 mM) has been used effectively for protein induction from D. turgidum

    • Consider reduced temperature during induction (20-30°C) to improve folding despite the thermophilic origin of the protein

    • Extended induction periods (18+ hours) have proven successful for other D. turgidum proteins

  • Protein solubilization:

    • Membrane protein extraction requires appropriate detergents

    • CellLytic B reagent has been used successfully for initial cell lysis of recombinant D. turgidum proteins

  • Refolding considerations:

    • Include zinc chelators during purification and refolding to prevent premature activation

    • Consider stepwise detergent exchange during purification to maintain structure

When expressing this thermophilic membrane protein in mesophilic hosts, researchers should carefully monitor for proper folding and insertion into membrane fractions as indicators of functional protein production.

How does D. turgidum HtpX compare functionally to homologs from other species?

The functional comparison between D. turgidum HtpX and its homologs from other species reveals important evolutionary adaptations and conserved mechanisms in proteolytic systems:

FeatureD. turgidum HtpXE. coli HtpXImplications
Thermal stabilityLikely high thermal stability due to thermophilic origin (optimal growth at 72°C) Moderate thermal stabilityD. turgidum HtpX may retain activity at higher temperatures, making it valuable for high-temperature bioprocessing applications
Zinc dependencyPresumed zinc-dependent based on homologyConfirmed zinc-dependent Conservation of catalytic mechanism across evolutionary distance
Membrane associationContains transmembrane regions similar to E. coli homologFour hydrophobic regions (H1-H4) with some controversy about C-terminal regions Suggests conservation of membrane topology despite adaptation to different membrane fluidity at high temperatures
Self-cleavage activityNot specifically reported in available dataExhibits self-cleavage when activated with Zn²⁺ Potential differences in auto-regulatory mechanisms may exist
Substrate specificityNot fully characterized in available dataDegrades casein and cleaves SecY Research opportunity to investigate whether substrate preferences differ in thermophilic versions

The thermophilic nature of D. turgidum likely contributes to unique structural features in its HtpX that enable function at elevated temperatures while maintaining the core proteolytic activities observed in mesophilic homologs. Further comparative studies could yield valuable insights into temperature adaptation of membrane proteases and potentially identify novel applications for the thermostable variant.

What are the challenges in identifying physiological substrates of HtpX in D. turgidum?

Identifying the physiological substrates of HtpX in D. turgidum presents several methodological and conceptual challenges:

  • Thermophilic growth conditions: D. turgidum's optimal growth at 72°C necessitates specialized cultivation systems that can maintain anaerobic conditions at high temperatures, making in vivo studies more technically demanding than for mesophilic organisms.

  • Membrane protein interactions: As HtpX is membrane-embedded, studying its interactions with potential substrates requires methods that preserve membrane integrity while allowing for detection of proteolytic events. This often requires careful optimization of detergent conditions that solubilize membranes without disrupting protein-protein interactions.

  • Proteolytic redundancy: Quality control systems typically involve multiple proteases with overlapping functions. As observed in E. coli, HtpX works in conjunction with FtsH , suggesting that knockout studies may not show clear phenotypes due to compensatory mechanisms.

  • Substrate transience: Degradation products are typically rapidly eliminated, making their detection challenging without specialized approaches like:

    • Protease-inactive mutants (e.g., mutations in the zinc-binding motif)

    • Quantitative proteomics comparing wild-type and htpX-deficient strains

    • Protein interaction studies under crosslinking conditions to capture transient enzyme-substrate complexes

  • Extremophile-specific considerations: The extremely thermophilic nature of D. turgidum may result in unique substrate profiles compared to mesophilic organisms, requiring researchers to look beyond known substrates from model organisms.

A promising approach would be to develop a model substrate system specifically for D. turgidum HtpX, similar to what has been established for E. coli HtpX , which could then serve as a platform for comparative analyses and substrate identification.

How might research on D. turgidum HtpX contribute to understanding protein quality control in extremophiles?

Research on D. turgidum HtpX offers unique insights into protein quality control mechanisms in extremophiles, with several significant implications:

  • Thermal adaptation of quality control systems: By studying how a proteolytic quality control enzyme functions at extremely high temperatures (optimum growth at 72°C) , researchers can elucidate specialized adaptations that maintain membrane protein homeostasis under conditions that would normally accelerate protein denaturation.

  • Structural insights into thermostability: Comparative structural studies between D. turgidum HtpX and mesophilic homologs could reveal specific modifications that confer thermal stability to membrane proteases, potentially identifying conserved thermostabilizing motifs applicable to protein engineering.

  • Evolution of proteolytic networks: D. turgidum represents an early-branching bacterial lineage, making its proteolytic systems valuable for understanding the evolution of protein quality control. The genome sequence reveals that despite its thermophilic nature, it has an unusually low G+C content (39.9%) , raising questions about how protein stability is maintained despite this genomic feature.

  • Biotechnological applications: Understanding the mechanisms of a thermostable membrane protease could lead to applications in:

    • Development of heat-resistant biocatalysts

    • Engineering improved protein expression systems for thermophilic enzymes

    • Creating new tools for structural and functional studies of membrane proteins

  • Ecological and adaptive significance: Research on HtpX can provide insights into how extremophiles maintain cellular function in harsh environments, contributing to our understanding of the limits of life and potential mechanisms for survival in extreme conditions.

By investigating the specific mechanisms by which D. turgidum HtpX functions at high temperatures, researchers can build a more comprehensive model of how protein quality control systems adapt to extreme conditions, with implications ranging from fundamental evolutionary biology to applied biotechnology.

What genetic manipulation techniques are available for studying HtpX function in D. turgidum?

Genetic manipulation of D. turgidum presents unique challenges due to its extremophilic nature, but several approaches can be employed to study HtpX function:

  • Heterologous expression systems:

    • Expression of D. turgidum HtpX in model organisms like E. coli allows for comparative functional studies

    • Complementation studies in htpX-deficient E. coli strains can assess functional conservation

    • Expression systems utilizing the pRham vector with rhamnose-inducible promoter have proven successful for other D. turgidum proteins

  • Site-directed mutagenesis approaches:

    • Targeting conserved domains, particularly the zinc-binding motifs essential for proteolytic activity

    • Creating catalytically inactive variants for substrate-trapping experiments

    • Developing activity assays that can detect differential protease activities of HtpX mutants

  • Chimeric protein construction:

    • Creating fusion proteins between thermophilic and mesophilic HtpX homologs to identify thermostability determinants

    • Developing reporter systems similar to the model substrate system established for E. coli HtpX

  • Genomic analysis approaches:

    • The complete genome sequence of D. turgidum is available, facilitating in silico analyses of the genetic context of the htpX gene

    • Comparative genomics with other thermophiles can identify conserved genetic elements associated with HtpX function

While direct genetic manipulation of D. turgidum remains challenging due to limited established transformation protocols for this organism, the combination of heterologous expression and comparative genomic approaches provides viable alternatives for studying HtpX function in this thermophilic bacterium.

How should researchers optimize storage and handling of recombinant D. turgidum HtpX to maintain activity?

Proper storage and handling of recombinant D. turgidum HtpX is critical for maintaining its structural integrity and enzymatic activity. Based on available information on similar proteins and thermophilic enzymes, the following guidelines are recommended:

  • Short-term storage conditions:

    • Store working aliquots at 4°C for up to one week to minimize freeze-thaw damage

    • Use Tris-based buffers with 50% glycerol to enhance stability

    • Consider including protease inhibitors (excluding zinc chelators if activity tests are planned) to prevent degradation by contaminating proteases

  • Long-term storage strategies:

    • Store at -20°C for standard storage periods

    • For extended storage, maintain at -80°C to further reduce molecular motion and potential degradation

    • Avoid repeated freezing and thawing cycles which can lead to protein denaturation

  • Activity preservation considerations:

    • Given the zinc-dependent nature of HtpX proteases, consider including zinc chelators during purification and storage to prevent self-degradation, but add Zn²⁺ when ready to assess enzymatic activity

    • For long-term activity preservation, lyophilization may be considered if properly optimized

  • Sample handling precautions:

    • When conducting experiments, minimize the time samples spend at room temperature

    • Consider the thermophilic nature of D. turgidum (optimal growth at 72°C) when designing activity assays and handling protocols

    • Prepare small working aliquots to limit freeze-thaw cycles of the main stock

  • Buffer optimization:

    • The protein has been successfully stored in Tris-based buffer with 50% glycerol

    • Buffer composition should be optimized specifically for the recombinant version being used

Following these guidelines will help researchers maintain the structural integrity and enzymatic activity of recombinant D. turgidum HtpX, thereby enhancing experimental reproducibility and reliability.

What are the key considerations for designing experiments to study HtpX substrate specificity?

Designing robust experiments to study HtpX substrate specificity requires careful consideration of multiple factors, particularly given the challenges associated with membrane proteases. Here are key methodological considerations:

  • Substrate candidate selection:

    • Begin with known substrates of HtpX homologs (e.g., SecY in E. coli)

    • Consider membrane proteins involved in stress response pathways

    • Include both membrane and soluble proteins (e.g., casein) as HtpX has demonstrated activity against both types

    • Prioritize thermostable proteins when working with the thermophilic D. turgidum HtpX

  • Experimental approaches for substrate identification:

    • In vivo model substrate systems: Develop or utilize model substrates similar to those established for E. coli HtpX, which enable semiquantitative detection of protease activity

    • Comparative proteomics: Compare proteome profiles between wild-type and HtpX-deficient strains under various stress conditions

    • Substrate-trapping approaches: Use catalytically inactive HtpX mutants to capture transient enzyme-substrate complexes

    • In vitro cleavage assays: Assess direct proteolytic activity against purified candidate substrates

  • Cleavage site determination strategies:

    • N-terminal sequencing of cleavage products

    • Mass spectrometry analysis of digestion fragments

    • Mutational analysis of putative cleavage sites in model substrates

  • Controls and validation:

    • Include protease-inactive HtpX mutants (e.g., mutations in zinc-binding motifs)

    • Perform competition assays with known substrates to confirm specificity

    • Validate findings across multiple experimental conditions and approaches

  • Thermophilic considerations:

    • Test activity and specificity across a temperature range to determine optimal conditions

    • Consider how membrane fluidity changes at different temperatures might affect substrate accessibility

  • Data analysis framework:

    • Develop quantitative metrics for substrate preference (e.g., kinetic parameters, cleavage efficiency)

    • Use bioinformatic approaches to identify common features among preferred substrates

    • Consider structural modeling to understand substrate-enzyme interactions

By systematically addressing these considerations, researchers can design comprehensive experimental approaches that will yield meaningful insights into the substrate specificity of D. turgidum HtpX protease.

What are the most promising applications of thermostable proteases like D. turgidum HtpX?

Thermostable proteases from extremophiles like D. turgidum HtpX offer unique advantages that open up numerous research and biotechnological applications:

  • Biocatalysis under extreme conditions:

    • High-temperature industrial processes where conventional enzymes would denature

    • Reactions requiring reduced microbial contamination risk due to elevated temperatures

    • Processes with improved reaction kinetics and substrate solubility at higher temperatures

  • Structural biology tools:

    • Selective proteolysis for structural studies of thermophilic membrane proteins

    • Limited proteolysis approaches that can be performed at elevated temperatures

    • Development of new protein engineering tools for thermostable protein design

  • Evolutionary and comparative studies:

    • Investigation of the molecular basis of protein thermostability

    • Understanding the evolution of quality control systems across the temperature spectrum

    • Elucidating how membrane-associated proteolytic systems adapt to different thermal environments

  • Biotechnological applications:

    • Development of heat-resistant recombinant protein production systems

    • Creation of self-cleaving protein tags that can be activated by temperature shifts

    • Novel approaches for controlled proteolysis in industrial settings

  • Analytical and diagnostic tools:

    • Thermostable components for diagnostic kits with improved shelf life

    • High-temperature protein analysis methods

The unique properties of D. turgidum HtpX, including its membrane association and zinc-dependent activity, combined with its presumed thermostability, make it particularly valuable for applications involving membrane protein processing or quality control under extreme conditions.

How might research on HtpX contribute to understanding antibiotic resistance mechanisms?

Research on HtpX proteases has significant potential to advance our understanding of antibiotic resistance mechanisms, particularly those involving membrane protein quality control systems:

  • Membrane stress response connections:

    • Many antibiotics target bacterial cell membranes or membrane proteins, triggering stress responses

    • HtpX is involved in quality control of membrane proteins , potentially playing a role in adaptive responses to membrane stress

    • Understanding how HtpX responds to antibiotic-induced membrane stress could reveal novel resistance mechanisms

  • Proteolytic regulation of resistance determinants:

    • HtpX may regulate the abundance or activity of membrane proteins involved in antibiotic resistance

    • Studying how HtpX affects the turnover of efflux pumps, porins, or other membrane components could identify new targets for antibiotic adjuvants

  • Cross-talk with other quality control systems:

    • HtpX works in conjunction with FtsH, another membrane-bound protease

    • This proteolytic network may constitute a coordinated response system that bacteria use to adapt to antibiotic stress

    • Mapping these interactions could identify critical nodes in resistance development

  • Comparative studies across bacterial species:

    • Analyzing HtpX function in antibiotic-resistant versus sensitive strains

    • Investigating whether thermophilic bacteria like D. turgidum have evolved unique proteolytic strategies that could inform approaches to combat resistance in pathogens

  • Potential therapeutic targets:

    • Inhibitors of HtpX or related proteases might sensitize bacteria to antibiotics that induce membrane stress

    • Understanding the structural features of HtpX from diverse bacterial species could aid in designing broad-spectrum protease inhibitors as antibiotic adjuvants

The study of HtpX across different bacterial species, including extremophiles like D. turgidum, provides a broader evolutionary context for understanding how bacterial proteolytic systems adapt to environmental stresses, which may share mechanistic features with adaptation to antibiotic exposure.

What are the remaining knowledge gaps in understanding the structure-function relationship of HtpX proteases?

Despite progress in characterizing HtpX proteases, several critical knowledge gaps remain in understanding their structure-function relationships:

  • Three-dimensional structure determination:

    • No high-resolution crystal or cryo-EM structure of HtpX from any species is currently available in the provided search results

    • The membrane-embedded nature of HtpX makes structural studies particularly challenging

    • Understanding the spatial arrangement of the catalytic domain relative to the membrane is crucial for elucidating its mechanism

  • Substrate recognition mechanisms:

    • The molecular determinants that govern HtpX substrate specificity remain poorly defined

    • Whether substrate recognition occurs within the membrane, at the membrane-cytosol interface, or both is unclear

    • The role of potential cofactors or accessory proteins in substrate delivery or recognition requires further investigation

  • Regulatory mechanisms:

    • How HtpX activity is regulated in response to different stress conditions

    • The significance of HtpX self-cleavage activity in regulation of its function

    • Potential post-translational modifications that might modulate activity

  • Thermoadaptation mechanisms in D. turgidum HtpX:

    • Specific structural features that allow the enzyme to function at high temperatures

    • How membrane association and dynamics change at elevated temperatures

    • Comparative analysis with mesophilic homologs to identify thermostabilizing elements

  • Physiological substrate profile:

    • Comprehensive identification of natural substrates in various bacterial species

    • Understanding substrate overlap and specificity differences between HtpX and other membrane proteases

    • Physiological consequences of HtpX deficiency in different bacterial species

  • Catalytic mechanism details:

    • Precise coordination geometry of the zinc ion in the active site

    • Conformational changes during catalysis

    • Role of specific conserved residues outside the zinc-binding motif

Addressing these knowledge gaps would significantly advance our understanding of HtpX function and could potentially lead to novel applications in biotechnology, structural biology, and even therapeutic development targeting bacterial quality control systems.

What are the recommended best practices for researchers beginning work with D. turgidum HtpX?

For researchers initiating studies on D. turgidum HtpX, the following best practices are recommended based on available information and experiences with related proteins:

  • Protein expression and purification:

    • Use expression systems that have proven successful for other D. turgidum proteins, such as the rhamnose-inducible pRham vector system

    • Purify under denaturing conditions to prevent self-degradation, followed by careful refolding in the presence of zinc chelators

    • Consider using detergent screening to identify optimal conditions for maintaining solubility while preserving native structure

  • Activity assessment approaches:

    • Establish a model substrate system similar to those developed for E. coli HtpX

    • Include both membrane protein substrates (e.g., SecY) and soluble substrates (e.g., casein) in initial characterization

    • Always maintain appropriate controls, including catalytically inactive mutants

  • Storage and handling:

    • Store in Tris-based buffer with 50% glycerol at -20°C for standard storage or -80°C for extended periods

    • Avoid repeated freeze-thaw cycles by preparing small working aliquots

    • Only add Zn²⁺ when ready to assess enzymatic activity to prevent premature activation and self-cleavage

  • Experimental design considerations:

    • Account for the thermophilic nature of D. turgidum (optimal growth at 72°C) when designing activity assays

    • Include temperature optimization studies to determine the temperature range for optimal activity

    • Consider the membrane-bound nature of the protein when designing experiments to study its function

  • Comparative approaches:

    • Design experiments that allow direct comparison with better-characterized homologs like E. coli HtpX

    • Consider creating chimeric proteins to identify domains responsible for thermostability

By following these recommendations, researchers can establish robust experimental systems for characterizing D. turgidum HtpX while minimizing common technical challenges associated with thermophilic membrane proteases.

What interdisciplinary approaches might advance understanding of HtpX function?

Advancing our understanding of HtpX function would benefit greatly from interdisciplinary approaches that combine techniques and perspectives from multiple scientific fields:

  • Structural biology and biophysics:

    • Cryo-electron microscopy for membrane protein structure determination

    • Nuclear magnetic resonance studies of domain dynamics

    • Molecular dynamics simulations to understand conformational changes during catalysis

    • Single-molecule biophysics to monitor protease-substrate interactions in real-time

  • Systems biology and proteomics:

    • Global proteomic profiling to identify physiological substrates

    • Network analysis to position HtpX within broader cellular stress response systems

    • Quantitative approaches to measure protein turnover rates in the presence/absence of HtpX

  • Synthetic biology and protein engineering:

    • Design of synthetic substrates with enhanced specificity

    • Engineering thermostable variants with modified substrate preferences

    • Creation of biosensors based on HtpX proteolytic activity

  • Evolutionary biology and comparative genomics:

    • Phylogenetic analysis of HtpX across bacterial species with different temperature optima

    • Ancestral sequence reconstruction to understand the evolution of thermostability

    • Comparison of genomic contexts to identify conserved functional associations

  • Computational biology approaches:

    • Machine learning to predict substrate preferences

    • Homology modeling and molecular docking to predict enzyme-substrate interactions

    • Sequence-based prediction of structural features contributing to thermostability

  • Microbiological and physiological studies:

    • Investigation of HtpX's role in stress responses under various conditions

    • Examination of phenotypic consequences of HtpX mutation or overexpression

The integration of these diverse approaches would provide complementary insights into HtpX function, potentially revealing unexpected aspects of its biological role and mechanisms of action.

What are the critical control experiments necessary for rigorous studies of HtpX activity?

To ensure scientific rigor in studies of HtpX activity, the following critical control experiments should be incorporated into experimental designs:

  • Enzyme activity controls:

    • Negative control: Catalytically inactive HtpX mutants (e.g., mutations in zinc-binding motifs) to confirm that observed activity is due to HtpX proteolytic function

    • Positive control: Known substrates such as casein or SecY (for E. coli HtpX) to validate assay functionality

    • Metal dependency: Tests with and without Zn²⁺ to confirm the zinc-dependent nature of the activity

    • Protease inhibitor controls: Specific inhibitors of metalloproteases to confirm the class of proteolytic activity

  • Substrate specificity controls:

    • Non-substrate proteins: Include proteins not expected to be cleaved to demonstrate specificity

    • Mutated substrate sites: Modification of putative cleavage sites to confirm specific recognition

    • Competition assays: Use of excess unlabeled substrate to compete with labeled substrate

    • Cross-species comparison: Testing whether substrates of HtpX from one species are recognized by HtpX from another

  • Expression and purification controls:

    • Western blot verification: Confirm protein identity and integrity

    • Size exclusion chromatography: Verify protein folding and oligomeric state

    • Activity after storage: Test activity retention after various storage conditions

    • Batch-to-batch consistency: Validate reproducibility between different protein preparations

  • Thermostability considerations:

    • Temperature range testing: Assess activity across a temperature gradient

    • Thermal shift assays: Monitor protein stability at different temperatures

    • Pre-incubation controls: Test effect of pre-incubation at different temperatures on activity

  • In vivo validation approaches:

    • Genetic complementation: Test whether D. turgidum HtpX can rescue phenotypes of htpX-deficient E. coli

    • Overexpression effects: Compare effects of wild-type versus catalytically inactive HtpX overexpression

    • Stress response correlation: Examine correlation between HtpX activity and cellular responses to various stresses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.