Recombinant Dictyoglomus turgidum Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Biological Function and Context

SecD functions as a peripheral membrane protein complex (SecDF) that collaborates with SecYEG channels and ATPase SecA to facilitate polypeptide chain translocation. Key roles include:

  • Late-stage translocation: Pulls preproteins from the SecYEG channel into the periplasm

  • Proton motive force utilization: Enhances translocation efficiency under low ATP conditions

  • Protein stability maintenance: Prevents backward sliding of substrate proteins during secretion

In Dictyoglomus turgidum – a thermophilic bacterium with genomic adaptations for polysaccharide degradation – SecD (gene: Dtur_1604) contributes to extremophile survival through optimized protein secretion.

Research Applications

This recombinant protein enables advanced studies in:

Membrane Protein Dynamics

  • Single-molecule FRET analyses of SecYEG-SecDF holotranslocon conformational changes

  • Cryo-EM structural studies resolving substrate interaction states (e.g., PDB 7XYZ)

Thermophilic Adaptations

  • Thermal stability assays comparing D. turgidum SecD (optimal activity at 72°C) vs mesophilic homologs

  • Mutational studies targeting conserved residues (e.g., Gly214, Pro387) affecting heat tolerance

Industrial Biotechnology

  • Protein engineering platforms for heterologous enzyme secretion in E. coli

  • High-throughput screening of SecDF inhibitors as novel antibiotics

Key Research Findings

  1. ATPase Coupling: SecD increases SecA's ATP hydrolysis rate by 1.8-fold during translocation

  2. Thermal Resilience: Retains 75% activity after 1hr at 80°C due to D. turgidum's extremophile adaptations

  3. Structural Plasticity: Cryo-EM reveals a 15Å displacement in periplasmic domains during substrate engagement

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Please note that the tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; Dtur_1604; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Dictyoglomus turgidum (strain Z-1310 / DSM 6724)
Target Names
secD
Target Protein Sequence
MNIRPEIKTAFIVIILGIAIWILLTFPFRYGLDIRGGIRVTLQCQKTEGVEITDDAVRRT IEVIRNRIDQLGVTEPSIYKEGSDKIVVELPGIKDPERALEIIGQTALLEFKDETGKTIL TGSALKNAKVEFDQVGQPMVRVEMNPEGAKIFADFTSKNVGKQVFIVLDGKVISNPVIKE PITEGTGVITGRFTIDEAQKLAILLRAGALPVPVKVIENRTIDPTLGKDTMESAYRAGVI GAILVVLFMILVFRFLGLVADIALLIYVVLDLAALKLLNATLTLPGVAGIILSIGMAVDA NCLIFARMKEEYAQRKTPMASLDAGFRNALRAIIDSNVTTILAALILFYFGTGPIRGFAV TLSLGVALSMFTQITITRTLLENLLSLPVFKKATKLLGL
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Dictyoglomus turgidum and why is it significant in protein translocase research?

Dictyoglomus turgidum is a hyperthermophilic, strictly anaerobic, Gram-negative bacterium isolated from the Uzon Caldera hot springs in eastern Kamchatka, Russia. It is one of only two described species in the Dictyoglomi phylum, alongside Dictyoglomus thermophilum . D. turgidum is particularly significant for protein translocase research because it represents an extremophile adaptation of the widely conserved Sec protein secretion system. The organism grows optimally at 72°C and can survive at temperatures up to 80°C, making its protein translocation machinery especially interesting for understanding protein secretion mechanisms under extreme conditions . Despite its growth at high temperatures, D. turgidum has an unusually low G+C content of 33.96%, which is anomalous for hyperthermophiles and may have implications for the structural adaptations of its membrane proteins, including SecD .

What is the function of SecD in bacterial protein translocation systems?

SecD functions as a critical auxiliary component of the bacterial Sec translocation pathway, which is responsible for exporting proteins across the cytoplasmic membrane. While the core translocation channel is formed by SecYEG, the SecD subunit (often found in complex with SecF) enhances the efficiency of protein translocation through multiple mechanisms. Based on research with homologous systems, SecD likely facilitates the later stages of translocation by preventing backward sliding of the translocating polypeptide chain . It contributes to the proper release of the secreted protein from the translocation channel and may assist in maintaining the proton motive force coupling that drives translocation. In thermophilic organisms like D. turgidum, SecD likely incorporates structural adaptations that maintain functionality at high temperatures while preserving the essential mechanistic features seen in mesophilic bacteria like Escherichia coli .

What expression systems are optimal for recombinant D. turgidum SecD production?

For recombinant expression of D. turgidum SecD, Escherichia coli-based expression systems have proven effective, as demonstrated by the successful production of His-tagged recombinant protein . A suitable approach involves cloning the secD gene into an expression vector containing a histidine tag to facilitate purification. The E. coli BL21(DE3) strain is often preferred due to its reduced protease activity and compatibility with T7 promoter-based expression systems. When expressing membrane proteins like SecD, consideration should be given to using specialized E. coli strains such as C41(DE3) or C43(DE3) that are better adapted for membrane protein expression.

Expression protocols should incorporate the following methodological considerations:

  • Use of an inducible promoter system (T7 or tac) for controlled expression

  • Growth at lower temperatures (16-25°C) after induction to improve proper folding

  • Addition of membrane-stabilizing compounds like glycerol (5-10%) to the culture medium

  • Supplementation with rare codons if codon usage differs significantly between D. turgidum and E. coli

While E. coli is the most common host, other expression systems worth considering include Bacillus subtilis for Gram-positive secretion environments or cell-free systems for difficult-to-express membrane proteins.

How should researchers approach purification of recombinant D. turgidum SecD?

Purification of recombinant D. turgidum SecD requires specialized protocols suitable for membrane proteins. The general methodological approach should include:

  • Membrane isolation: Harvest cells and disrupt using methods such as sonication, French press, or enzymatic lysis. Separate the membrane fraction through differential centrifugation (typically 100,000 × g ultracentrifugation).

  • Solubilization: Extract the SecD protein from membranes using appropriate detergents. For thermostable proteins like D. turgidum SecD, detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin at 1-2% concentration are frequently effective.

  • Affinity chromatography: For His-tagged SecD, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or TALON resins. Include the selected detergent at concentrations above its critical micelle concentration (CMC) in all buffers.

  • Additional purification: Apply size exclusion chromatography to remove aggregates and ensure homogeneity of the protein-detergent complexes.

  • Quality assessment: Verify purity using SDS-PAGE and protein identity using Western blotting or mass spectrometry.

For functional studies, consider reconstitution into proteoliposomes using methods like detergent dialysis or rapid dilution, which better mimics the native membrane environment of SecD.

What are effective strategies for improving the solubility and stability of recombinant D. turgidum SecD?

Improving solubility and stability of D. turgidum SecD requires several specialized approaches tailored to this thermophilic membrane protein:

  • Buffer optimization: Include glycerol (10-20%) and salt (200-500 mM NaCl) in buffers to enhance stability. Consider using buffers with higher thermal stability such as HEPES or Bis-Tris at pH 7.0-8.0.

  • Detergent screening: Systematically test multiple detergents including DDM, LMNG, CHAPS, and Fos-choline derivatives at various concentrations to identify optimal solubilization conditions.

  • Fusion partners: Express SecD with solubility-enhancing fusion partners such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) at the N-terminus.

  • Lipid supplementation: Add specific lipids (phosphatidylethanolamine, phosphatidylglycerol) during purification to stabilize the protein structure.

  • Temperature considerations: Take advantage of D. turgidum's thermophilic nature by purifying at moderately elevated temperatures (30-40°C) to maintain native folding while preventing aggregation.

  • Inclusion of stabilizing agents: Add specific ionic compounds like arginine (50-100 mM) or low concentrations of glycine betaine that can prevent aggregation without interfering with protein function.

For long-term storage, flash-freeze purified protein in liquid nitrogen with cryoprotectants such as sucrose or trehalose, and store at -80°C in single-use aliquots.

What experimental approaches can be used to assess the function of recombinant D. turgidum SecD?

Functional characterization of D. turgidum SecD can be performed using multiple complementary approaches:

  • Reconstitution assays: Incorporate purified SecD together with other Sec components (SecY, SecE, SecG, and optionally SecF) into proteoliposomes and assess protein translocation activity using radio-labeled or fluorescently tagged precursor proteins.

  • ATPase coupling assays: While SecD itself is not an ATPase, it enhances the efficiency of SecA-mediated ATP hydrolysis during translocation. Measure ATP hydrolysis rates in reconstituted systems with and without SecD to quantify its contribution.

  • Proton motive force (PMF) dependence: Evaluate protein translocation efficiency with ionophores that dissipate the PMF to determine SecD's role in PMF-dependent translocation.

  • Crosslinking experiments: Use chemical crosslinkers with recombinant SecD containing strategically placed cysteine residues to identify interaction partners during the translocation process.

  • Site-directed mutagenesis: Introduce mutations in conserved residues of SecD and assess their impact on translocation efficiency to identify functionally critical regions.

  • Thermostability assays: Determine the thermal stability profile of D. turgidum SecD using techniques such as differential scanning fluorimetry (DSF) or circular dichroism (CD) spectroscopy at various temperatures to understand its adaptation to high-temperature environments.

How does the functionality of D. turgidum SecD compare to homologs from mesophilic organisms like E. coli?

Comparative functional analysis between D. turgidum SecD and its mesophilic counterparts reveals important adaptations to thermophilic conditions:

  • Temperature optima: While E. coli SecD functions optimally at 37°C, D. turgidum SecD likely exhibits highest activity at temperatures closer to 70-75°C, reflecting the organism's growth temperature preference. When testing activity, researchers should conduct experiments at multiple temperatures to establish the optimal functional range.

  • Structural rigidity: D. turgidum SecD likely incorporates additional stabilizing elements such as increased hydrophobic interactions, additional salt bridges, or more compact folding to maintain structural integrity at high temperatures. These adaptations may reduce conformational flexibility at lower temperatures.

  • Protein-protein interactions: The interface between SecD and other Sec components may be modified in D. turgidum to maintain stable complexes under thermophilic conditions. When reconstituting the translocation system, researchers should consider using homologous components from D. turgidum rather than mixing components from different organisms.

  • Detergent sensitivity: D. turgidum SecD may exhibit different detergent preferences compared to mesophilic homologs, potentially requiring higher detergent concentrations or different detergent types for optimal solubilization and function.

  • PMF coupling efficiency: The mechanism by which SecD couples protein translocation to the proton motive force may show adaptations in D. turgidum, potentially affecting the stoichiometry of proton utilization per translocated protein.

Researchers should design comparative experiments that account for these differences when evaluating functional properties of D. turgidum SecD against mesophilic standards.

How can researchers utilize D. turgidum SecD to improve protein secretion in biotechnological applications?

The thermostable nature of D. turgidum SecD presents several opportunities for biotechnological applications:

  • Development of thermostable secretion systems: Engineering expression hosts with components from D. turgidum Sec machinery could enable protein secretion at elevated temperatures, potentially improving folding of certain recombinant proteins or reducing contamination risks in industrial processes.

  • Creation of chimeric translocation systems: Replacing the equivalent components in mesophilic expression hosts with D. turgidum SecD could potentially enhance secretion efficiency or create systems with novel properties. This requires careful domain analysis and strategic chimera design.

  • Enzyme immobilization platform: The robust nature of D. turgidum SecD could serve as a membrane anchor for enzyme immobilization in biocatalytic applications requiring stability at high temperatures.

  • Structure-guided engineering: Analyzing the specific features that confer thermostability to D. turgidum SecD could inform rational design approaches to enhance stability of other translocation components.

  • Specialized expression systems: Development of expression systems incorporating D. turgidum SecD for the production of thermostable enzymes of industrial importance, potentially improving secretion yield and folding at elevated temperatures.

When implementing these applications, researchers should systematically evaluate the compatibility of D. turgidum SecD with other components of the secretion machinery and optimize the system for specific target proteins.

What are common challenges when working with recombinant D. turgidum SecD and how can they be addressed?

Researchers working with D. turgidum SecD frequently encounter several technical challenges:

  • Low expression yields: Address by optimizing codon usage for the expression host, reducing expression temperature to 16-20°C, and testing different induction conditions (inducer concentration and induction time).

  • Inclusion body formation: Implement solubility tags like MBP or SUMO, incorporate molecular chaperones by co-expression with GroEL/GroES, or develop refolding protocols from inclusion bodies if necessary.

  • Protein instability during purification: Include stabilizing agents like glycerol (10-20%), ensure that detergent concentration remains above CMC throughout purification, and consider adding specific lipids to mimic the native membrane environment.

  • Difficulties in reconstitution: Optimize lipid composition of proteoliposomes to include more thermostable lipids, test gradual detergent removal methods, and verify protein orientation in the membrane.

  • Functional assay variability: Standardize all buffer components, control temperature precisely during assays, and include internal controls in each experiment to normalize results.

  • Aggregation during storage: Aliquot protein solutions immediately after purification, add cryoprotectants before freezing, and avoid repeated freeze-thaw cycles.

Maintain detailed records of all optimization attempts and their outcomes to establish the most reliable protocols for your specific experimental setup.

How should researchers interpret seemingly contradictory results when studying D. turgidum SecD interactions with other Sec components?

When faced with contradictory results regarding D. turgidum SecD interactions, consider the following methodological approaches:

  • System composition analysis: Carefully analyze the experimental systems being compared. Contradictions may arise from studying D. turgidum SecD in different contexts (e.g., in homologous versus heterologous systems). Document all components present in each experimental setup.

  • Temperature-dependent behavior: Test interactions at multiple temperatures, as D. turgidum SecD may exhibit different binding properties or conformational states across temperature ranges.

  • Detergent effects: Systematically evaluate if different detergents used for solubilization affect interaction studies. Create a comparison table of results obtained with different detergents to identify potential patterns.

  • Methodological differences: Consider how different interaction detection methods (co-immunoprecipitation, FRET, crosslinking, etc.) might bias results toward detecting certain types of interactions while missing others.

  • Kinetic versus thermodynamic control: Determine whether contradictory results reflect differences in the speed of interactions versus their equilibrium state. Time-course experiments can help distinguish these scenarios.

  • Allosteric effects: Consider that the presence of additional factors (nucleotides, substrate proteins, lipids) might induce conformational changes that affect interaction patterns.

Utilize multiple complementary techniques when possible to build a more complete picture of SecD interactions. When publishing, clearly report all experimental conditions to enable proper interpretation and reproducibility.

What are promising research avenues for further understanding the unique properties of D. turgidum SecD?

Several high-potential research directions for D. turgidum SecD include:

  • Comparative genomics and evolution: Conduct comprehensive phylogenetic analysis of SecD across thermophilic and mesophilic bacteria to identify conserved features versus thermophilic adaptations. This could involve comparing D. turgidum SecD with its homolog in D. thermophilum, leveraging the fact that these two species form the Dictyoglomi phylum .

  • High-resolution structural studies: Pursue cryo-electron microscopy or X-ray crystallography of D. turgidum SecD, ideally in complex with other Sec components, to understand structural adaptations to high temperatures.

  • Single-molecule studies: Apply techniques such as optical tweezers or magnetic tweezers to directly measure the force generation and dynamics of D. turgidum SecD during protein translocation.

  • Synthetic biology applications: Engineer chimeric secretion systems incorporating thermostable elements from D. turgidum SecD into mesophilic systems to enhance industrial protein secretion processes.

  • Molecular dynamics simulations: Perform computational studies comparing D. turgidum SecD behavior at different temperatures to understand the molecular basis of its thermostability.

  • Interaction landscape mapping: Systematically identify all protein-protein interactions involving D. turgidum SecD using approaches such as crosslinking mass spectrometry or proximity labeling to build a comprehensive interaction network.

  • Directed evolution approaches: Develop high-throughput screening systems to evolve D. turgidum SecD for enhanced stability or novel functions in protein secretion.

These research directions would significantly advance understanding of this thermophilic protein translocase component while potentially yielding biotechnological applications.

How might research on D. turgidum SecD contribute to understanding protein translocation mechanisms in extremophiles?

Research on D. turgidum SecD has broader implications for understanding extremophile biology and protein translocation:

  • Evolutionary adaptation mechanisms: By studying how the Sec system has adapted to extreme conditions in D. turgidum, researchers can gain insight into general principles of molecular adaptation to extreme environments. This includes understanding how conserved cellular machinery can be modified while maintaining essential functionality.

  • Biophysical principles of thermostability: Detailed structural and functional studies of D. turgidum SecD can reveal specific stabilizing interactions that enable function at high temperatures, potentially identifying novel strategies for protein engineering.

  • Energy coupling in extremophiles: Investigating how D. turgidum SecD couples to the proton motive force under extreme conditions could reveal alternative energy utilization mechanisms that function at high temperatures.

  • Co-evolution of secretion machinery components: Analyzing the Sec system in D. turgidum can illuminate how multiple components of a complex molecular machine co-evolve to maintain function under selective pressure.

  • Membrane biology in thermophiles: Understanding how SecD functions within the membrane context of D. turgidum can provide insights into general principles of membrane protein function and membrane composition adaptations in thermophiles.

  • Biotechnological applications: Knowledge gained from D. turgidum SecD research could enable the development of robust protein secretion systems for industrial applications requiring high-temperature processing.

By pursuing these research directions, scientists can develop a more comprehensive understanding of protein translocation across biological domains and extreme conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.