Recombinant Dictyostelium citrinum NADH-ubiquinone oxidoreductase chain 4L (nad4L)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Dictyostelium citrinum NADH-ubiquinone oxidoreductase chain 4L (nad4L) is a heterologously expressed protein derived from the slime mold Dictyostelium citrinum. This protein corresponds to subunit 4L of Complex I (NADH dehydrogenase), a critical component of the mitochondrial electron transport chain (ETC). The native protein is encoded by the mitochondrial gene nad4L and shares structural and functional homology with human mitochondrial subunits such as MT-ND4L .

Functional Role in Mitochondrial Respiration

The nad4L subunit is part of the minimal core assembly of Complex I, which catalyzes electron transfer from NADH to ubiquinone and pumps protons across the mitochondrial inner membrane . Key functions include:

  • Electron Transfer: Facilitates the transfer of electrons through iron-sulfur clusters to ubiquinone .

  • Proton Translocation: Contributes to the proton gradient required for ATP synthesis via oxidative phosphorylation .

  • Structural Integrity: Plays a role in stabilizing the L-shaped architecture of Complex I, which includes hydrophobic transmembrane and hydrophilic peripheral arms .

Production Methodology

The recombinant nad4L is synthesized in E. coli via plasmid-based expression systems. Key steps include:

  1. Cloning: Insertion of the nad4L coding sequence into a bacterial expression vector.

  2. Induction: Expression induced under optimized conditions (e.g., IPTG induction).

  3. Purification: Affinity chromatography via the His-tag .

Research Applications

ApplicationDetails
Structural StudiesAnalysis of Complex I assembly using techniques like cryo-EM or X-ray crystallography
Functional AssaysReconstitution of Complex I activity in vitro to study electron transfer kinetics
Disease ModelingStudy of mitochondrial dysfunction linked to mutations in homologous human subunits (e.g., LHON)
Genetic StudiesCRISPR-based gene editing in Dictyostelium to explore nad4L’s role in development

Comparative Analysis with Native and Human Homologs

FeatureRecombinant D. citrinum nad4LNative D. citrinum nad4LHuman MT-ND4L
LocalizationCytoplasmic (after E. coli expression)Mitochondrial matrixMitochondrial matrix
Gene OriginHeterologous expressionMitochondrial genomeMitochondrial genome
Disease RelevanceLimited (model organism studies)LimitedLHON, metabolic disorders
Sequence Identity100% (self) vs. ~30% to human 100%N/A

Research Findings and Implications

  • Evolutionary Insights: The nad4L gene in Dictyostelium clusters with other mitochondrial genes like nad9 and rps4, suggesting conserved genomic organization .

  • Developmental Role: Mitochondrial ribosomal proteins (e.g., RPS4) and nad4L are implicated in starvation-induced differentiation in Dictyostelium, linking ETC activity to cell fate decisions .

  • Disease Connections: Mutations in human MT-ND4L (e.g., V65A) disrupt Complex I function, causing optic neuropathy. While not directly studied in D. citrinum, the recombinant protein serves as a model for understanding subunit-specific pathologies .

Supplier and Availability

The recombinant nad4L is commercially available from multiple biotech companies, including MyBioSource , Creative Biomart , and GeneBioSystems . Typical product specifications include:

  • Catalog Numbers: MBS7056293 (MyBioSource), RFL21036DF (Creative Biomart)

  • Form: Lyophilized powder or solution in Tris-based buffer

  • Purity: ≥90% (SDS-PAGE confirmed)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nad4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Dictyostelium citrinum (Slime mold)
Target Names
nad4L
Target Protein Sequence
MNLIDLILIAIYVIGISGLIFNKNNIINILIISELNLGTLGMLFVLASVELNDILGELSG LYILTFTAAESAIGLAIVVILYSKTGIINIRNLNKLKG
Uniprot No.

Target Background

Function
The NADH-ubiquinone oxidoreductase chain 4L (nad4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered essential for the minimal assembly required for catalytic activity. Complex I plays a crucial role in the transfer of electrons from NADH to the respiratory chain. Ubiquinone is believed to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What are the optimal protocols for handling recombinant nad4L protein from Dictyostelium citrinum?

Based on protocols for similar recombinant proteins from Dictyostelium species, optimal handling of recombinant nad4L requires careful temperature management and detergent selection. For storage, the protein should be maintained at -20°C for regular use, or at -80°C for extended storage periods . When working with the protein, it's advisable to prepare small working aliquots to avoid repeated freeze-thaw cycles, with these aliquots being viable at 4°C for approximately one week .

For buffer composition, a Tris-based buffer with 50% glycerol provides stability for membrane proteins like nad4L . The choice of detergent is critical for maintaining protein function - lauryl maltose neopentyl glycol (LMNG) has demonstrated superior results in stabilizing complex I components while preserving enzymatic activity, making it potentially suitable for nad4L preparation . For experimental work involving electron transport activity measurements, it's essential to maintain reducing conditions and protect the protein from oxidative damage during handling.

What expression systems are most effective for producing recombinant Dictyostelium citrinum nad4L?

When producing recombinant Dictyostelium proteins, the expression system selection significantly impacts yield and functionality. For membrane proteins like nad4L, eukaryotic expression systems generally provide better results than bacterial systems due to their capacity for post-translational modifications and membrane protein folding. Based on protocols for similar proteins, recommended systems include:

  • Insect cell expression systems: Baculovirus-infected Sf9 or High Five cells provide an environment conducive to proper folding of membrane proteins.

  • Yeast expression systems: Particularly Pichia pastoris, which combines high expression levels with eukaryotic processing capabilities.

  • Mammalian cell expression: HEK293 or CHO cells for cases where complex folding or specific modifications are required.

Each system requires optimization of expression conditions, including induction timing, temperature, and harvesting protocols. For membrane proteins like nad4L, co-expression with chaperones may improve correct folding and yield. The choice of purification tags should balance detection ease with minimal interference in protein function, with His-tags being commonly used but requiring validation to ensure they don't disrupt the protein's functional properties in electron transport assays .

What is the evolutionary significance of nad4L in Dictyostelium citrinum compared to other species?

The nad4L gene represents an interesting evolutionary case study across species, particularly within the Dictyostelia. While specific information about Dictyostelium citrinum nad4L evolution is limited in the provided search results, the evolutionary patterns observed in other Dictyostelium genes suggest selective pressures that may apply to nad4L as well. The emergence of specialized cell types in Dictyostelia, particularly in group 4 (which includes D. discoideum), has been associated with gene duplication events followed by functional diversification .

For mitochondrial proteins like nad4L, evolutionary conservation reflects their fundamental role in cellular energetics, with sequence variations potentially reflecting adaptation to different metabolic demands or environmental conditions. Comparative analysis of nad4L sequences across Dictyostelium species could reveal signatures of selection pressure similar to those observed for the cdl1 transcription factor, where duplication followed by divergence contributed to novel cellular specialization . This evolutionary context provides valuable insights for researchers studying the structure-function relationships of nad4L across species.

What are the most effective purification techniques for maintaining nad4L functional integrity?

Purification of recombinant nad4L presents significant challenges due to its hydrophobic nature and vulnerability to denaturation when removed from its native membrane environment. Based on successful purification protocols for complex I components, a multi-step approach is recommended:

  • Membrane preparation: Cell lysis should be performed using gentle methods such as nitrogen cavitation or osmotic shock rather than sonication to prevent protein damage.

  • Detergent solubilization: Critical screening of detergents is essential, with lauryl maltose neopentyl glycol (LMNG) emerging as particularly effective for complex I components . Initial solubilization should use detergent concentrations 5-10 times the critical micelle concentration (CMC), followed by purification buffers with concentrations just above the CMC.

  • Affinity chromatography: His-tagged proteins can be purified using Ni-NTA resin with imidazole gradients optimized to minimize non-specific binding while maximizing target protein recovery.

  • Size exclusion chromatography: This final polishing step separates aggregates and contaminants while allowing buffer exchange to conditions optimal for downstream applications.

Throughout purification, protein stability should be monitored using activity assays specific to complex I function, such as NADH:ubiquinone oxidoreductase activity measured spectrophotometrically . The purification yield and purity can be assessed through SDS-PAGE, while structural integrity can be evaluated using circular dichroism or limited proteolysis approaches.

How can researchers differentiate between functional and non-functional conformations of purified nad4L?

Distinguishing functional from non-functional conformations of membrane proteins like nad4L requires multiple analytical approaches:

  • Spectroscopic techniques: Circular dichroism (CD) spectroscopy can assess secondary structure integrity, while fluorescence spectroscopy can detect changes in tertiary structure. These methods establish baseline characteristics of properly folded nad4L.

  • Activity assays: Functional nad4L should demonstrate NADH:ubiquinone oxidoreductase activity when reconstituted with other complex I components. Monitoring NADH oxidation at 340 nm provides a quantitative measure of electron transfer capability .

  • Reconstitution studies: Incorporation of purified nad4L into liposomes or nanodiscs creates a membrane-like environment for function assessment. Proton translocation can be measured using pH-sensitive fluorescent dyes or electrochemical techniques.

  • Thermal stability analysis: Differential scanning fluorimetry (DSF) or differential scanning calorimetry (DSC) can assess protein stability, with properly folded nad4L showing cooperative unfolding transitions.

  • Interaction analysis: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can verify binding to known interacting partners within complex I, confirming native-like conformational states.

The combination of these approaches provides comprehensive assessment of nad4L conformational integrity, essential for structure-function studies and comparative analysis across species or mutant variants.

What are the optimal approaches for studying nad4L interactions with other complex I subunits?

Investigating protein-protein interactions within large multimeric complexes like complex I requires specialized techniques that preserve native associations while enabling specific detection. For nad4L interaction studies, researchers should consider:

  • Crosslinking mass spectrometry (XL-MS): This technique uses chemical crosslinkers to capture transient interactions followed by mass spectrometry identification of interaction sites. For nad4L, membrane-permeable crosslinkers with varying spacer lengths can identify distance constraints between interacting subunits.

  • Co-immunoprecipitation with tagged constructs: Expression of tagged nad4L permits pulldown experiments to identify interacting partners, though careful validation is required to ensure tags don't disrupt native interactions.

  • FRET-based approaches: Fluorescently labeled nad4L and potential partner subunits can reveal proximity and dynamic interactions within the intact complex through Förster resonance energy transfer measurements.

  • Cryo-electron microscopy: While challenging for individual subunits, cryo-EM of partially assembled complexes can reveal the structural context of nad4L within complex I architecture .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique identifies regions of nad4L that show altered solvent accessibility when bound to partner proteins, providing insights into interaction interfaces.

How do post-translational modifications affect nad4L function in Dictyostelium citrinum?

While specific information about post-translational modifications (PTMs) of D. citrinum nad4L is not provided in the search results, research on complex I subunits across species suggests several potential regulatory modifications:

  • Phosphorylation sites: Membrane subunits of complex I may contain phosphorylation sites that modulate protein-protein interactions or conformational changes. These modifications can be mapped using phosphoproteomics approaches combining enrichment strategies with mass spectrometry analysis.

  • Oxidative modifications: As components of the electron transport chain, complex I subunits are susceptible to oxidative stress-induced modifications such as carbonylation or sulfoxidation. These modifications may serve as biomarkers of respiratory chain dysfunction or stress response.

  • Acetylation: This modification has been identified in several mitochondrial proteins and may regulate complex I activity in response to metabolic status.

To study these modifications in nad4L, researchers should employ mass spectrometry-based approaches with appropriate enrichment strategies. For functional assessment, site-directed mutagenesis of putative modification sites can generate non-modifiable variants for comparative functional studies. Additionally, in vitro enzymatic assays using purified kinases, acetylases, or oxidizing agents can establish the susceptibility of nad4L to specific modifications and their functional consequences for electron transport and proton pumping activities.

What approaches are most effective for studying the role of nad4L in mitochondrial dysfunction models?

Investigating nad4L's role in mitochondrial dysfunction requires model systems that allow manipulation of this gene while enabling assessment of cellular and organismal phenotypes:

  • CRISPR/Cas9 gene editing: Creating specific mutations in the nad4L gene of Dictyostelium allows precise examination of structure-function relationships. Based on evolutionary studies in Dictyostelia, knockout and knockin approaches can reveal phenotypic consequences similar to those observed for other genes .

  • Heterologous expression systems: Human cell lines with OXPHOS deficiencies can be complemented with wild-type or mutant versions of nad4L to assess functional conservation across species.

  • In vitro reconstitution: Purified recombinant nad4L (wild-type and mutant variants) can be incorporated into proteoliposomes with other complex I subunits to assess bioenergetic functions.

  • Metabolic profiling: Liquid chromatography-mass spectrometry (LC-MS) metabolomics can identify metabolic signatures associated with nad4L dysfunction, particularly focusing on NADH/NAD+ ratios, TCA cycle intermediates, and oxidative stress markers.

  • Mitochondrial functional assays: Oxygen consumption rate (OCR) measurements, membrane potential assessments, and ATP production assays provide quantitative measures of mitochondrial function impacted by nad4L modifications.

The combination of molecular, cellular, and biochemical approaches creates a comprehensive understanding of nad4L's role in mitochondrial function and how its dysfunction contributes to energy metabolism disorders.

What are the key considerations for developing antibodies against Dictyostelium citrinum nad4L?

Developing specific antibodies against membrane proteins like nad4L presents unique challenges that require targeted strategies:

  • Epitope selection: For integral membrane proteins like nad4L, hydrophilic regions that extend into aqueous environments make the most accessible epitopes. Computational tools for epitope prediction should be employed to identify regions that combine surface accessibility with sequence uniqueness.

  • Immunogen preparation: Options include:

    • Synthetic peptides corresponding to hydrophilic regions

    • Recombinant protein fragments expressing extramembrane domains

    • Full-length protein purified in detergent micelles

  • Antibody production platforms:

    • Monoclonal antibody development through hybridoma technology offers high specificity

    • Recombinant antibody libraries (phage display) allow selection under defined conditions

    • Polyclonal antibodies provide recognition of multiple epitopes

  • Validation strategies:

    • Western blotting against recombinant protein and native samples

    • Immunoprecipitation followed by mass spectrometry confirmation

    • Immunolocalization studies to confirm mitochondrial targeting

    • Use of nad4L knockout/knockdown samples as negative controls

  • Cross-reactivity assessment: Testing against related proteins from different Dictyostelium species helps establish specificity and potential for cross-species applications .

Well-characterized antibodies become valuable tools for protein detection, localization studies, and interaction analysis, contributing significantly to nad4L research across multiple experimental approaches.

How can researchers effectively compare nad4L from Dictyostelium citrinum with homologues in other species?

Comparative analysis of nad4L across species provides valuable insights into evolutionary conservation, functional constraints, and species-specific adaptations. Recommended approaches include:

  • Sequence analysis: Multiple sequence alignment tools like Clustal Omega or MUSCLE can identify conserved residues and variable regions across species. Key parameters to analyze include:

    Analysis TypeToolsOutput Parameters
    Conservation analysisConSurf, Rate4SitePer-residue conservation scores
    Hydropathy analysisTMHMM, TOPCONSTransmembrane region prediction
    Functional domain mappingInterPro, PFAMConserved domain architecture
    Positive selection detectionPAML, FELdN/dS ratios, selective pressure
  • Structural comparison: Homology modeling using AlphaFold2 or SWISS-MODEL can generate structural predictions based on known templates, enabling visualization of conserved structural elements versus variable regions.

  • Functional complementation: Expression of D. citrinum nad4L in model organisms with nad4L mutations can assess functional conservation. Similar approaches have proven valuable in understanding gene evolution in Dictyostelia .

  • Evolutionary rate analysis: Phylogenetic methods can assess whether nad4L underwent duplication events similar to those observed for other genes in Dictyostelia evolution, potentially indicating functional diversification .

This multi-faceted approach creates a comprehensive evolutionary profile of nad4L, placing the D. citrinum protein in broader context and potentially revealing specialized adaptations related to the organism's ecological niche and metabolic requirements.

What are the emerging technologies for studying nad4L integration into complex I assembly pathways?

Investigating how nad4L incorporates into the complex I assembly pathway represents an important frontier in understanding mitochondrial biogenesis. Emerging technologies enabling these studies include:

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify transient interaction partners during the assembly process when expressed in Dictyostelium or heterologous systems.

  • Single-molecule tracking: Fluorescently tagged nad4L visualized using super-resolution microscopy techniques such as PALM or STORM can reveal the dynamic process of incorporation into nascent complex I.

  • Time-resolved cryo-electron microscopy: This technique can capture intermediate assembly states, providing structural snapshots of nad4L integration into the growing complex.

  • Ribosome profiling: Applied to mitochondrial translation, this approach can determine the timing of nad4L synthesis relative to other complex I components, informing assembly sequence models.

  • Pulse-chase proteomics: Stable isotope labeling combined with mass spectrometry can track the kinetics of nad4L incorporation into assembly intermediates.

These technologies collectively provide a dynamic view of nad4L's journey from synthesis to final incorporation in functional complex I, with implications for understanding both normal assembly processes and pathological situations where assembly is compromised .

How might nad4L be utilized in synthetic biology applications for energy production systems?

The integration of nad4L into synthetic biology platforms represents an innovative frontier with potential applications in bioenergy production and bioremediation. Strategic approaches include:

  • Minimal respiratory chain design: Simplified electron transport chains incorporating optimized nad4L variants could be engineered into artificial membrane systems or minimal cells for controlled energy production.

  • Enhanced biofuel cells: Incorporating nad4L and associated complex I components into electrode-coupled membrane systems could enable NADH oxidation coupled to electricity generation.

  • Biosensor development: nad4L-based systems could serve as sensitive detectors for mitochondrial toxins or inhibitors, with applications in environmental monitoring and pharmaceutical screening.

  • Cross-species optimization: Drawing from the evolutionary diversity of nad4L across species, including Dictyostelium citrinum, chimeric proteins combining features from different organisms could yield enhanced properties for specific applications .

  • Directed evolution approaches: Creating libraries of nad4L variants followed by selection for desired properties (stability, activity, substrate specificity) could generate specialized versions for biotechnological applications.

These applications build on fundamental research into nad4L structure and function, translating basic science insights into applied technologies with potential environmental and energy production benefits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.