Recombinant Dictyostelium discoideum 4-hydroxybenzoate polyprenyltransferase, mitochondrial (coq2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To prioritize a specific tag, please inform us during your order.
Synonyms
coq2; DDB_G0281241; 4-hydroxybenzoate polyprenyltransferase, mitochondrial; 4-HB polyprenyltransferase; Para-hydroxybenzoate--polyprenyltransferase; PHB:PPT; PHB:polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-463
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
coq2"
Target Protein Sequence
SILKYNNNNNTNNNNNNNGINKYNSTFNNNNSNFSNKNLFSSKQYQQQSICNIPILSTIS YHNKNNTNINTIINNNNSSNNNLINLNDKFNNLNNKTSPIIFNKNYSTTVSTLLDDNNSN SNNNNNSNNNKPSTTFVNDWISKFPNSVQPYLRLSRVDKPIGVWLLLYPCCWSISLAAPA GSFPDLKTMLVFGIGAYVMRSAGCVINDMADYKFDSKVERTKTRPIASKQLTHKQSLIFL GGQLLASFGLILSSLNYYTIALCASSLPIVVLYPFMKRFTYYPQFVLGLAFNWGALAGYS AIAGSCNWSIVAPLYLAGISWTMVYDTIYAHQDKRDDILVGVKSTALKFAEKSRIILSVF SGLVISGMFLTGIAANMPLFYYLGTAACSSHLIWQLKTVDFNNPSSCLEKFISNKNFGLY FLLIIIVSKLLQDKENENEIQKK
Uniprot No.

Target Background

Function

This recombinant Dictyostelium discoideum 4-hydroxybenzoate polyprenyltransferase (mitochondrial, CoQ2) catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in coenzyme Q (CoQ) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB. This generates the initial membrane-bound Q intermediate.

Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.

Q&A

What is the function of coq2 in Dictyostelium discoideum?

The coq2 gene in D. discoideum encodes 4-hydroxybenzoate polyprenyltransferase, a mitochondrial enzyme that catalyzes a critical early step in the coenzyme Q (ubiquinone) biosynthesis pathway. This enzyme transfers a polyprenyl group from polyprenyl pyrophosphate to 4-hydroxybenzoate, forming 3-polyprenyl-4-hydroxybenzoate. This reaction represents the first committed step in the ubiquinone biosynthetic pathway.

Coenzyme Q functions as an essential electron carrier in the mitochondrial respiratory chain, playing crucial roles in energy production through oxidative phosphorylation. Additionally, it serves as an important antioxidant in cellular membranes. In D. discoideum, the function of coq2 is conserved with its human orthologue, making it valuable for studying ubiquinone biosynthesis disorders .

How is the coq2 gene conserved between D. discoideum and humans?

D. discoideum contains a significant number of human orthologues (approximately 22%), which is comparable to more complex model organisms like D. melanogaster and C. elegans, but higher than in yeast models like S. cerevisiae or S. pombe . The coq2 gene demonstrates substantial conservation at both sequence and functional levels.

Key conservation features include:

  • Preservation of catalytic domains and active site residues essential for substrate recognition

  • Conservation of mitochondrial targeting sequences, though with some organism-specific variations

  • Maintained ability to complement coq2 mutations across species, demonstrating functional conservation

This high degree of conservation allows researchers to use D. discoideum coq2 as a model for understanding human coq2 function and ubiquinone biosynthesis disorders.

What are the optimal expression systems for recombinant D. discoideum coq2?

Several expression systems have been successfully employed for recombinant production of D. discoideum coq2, each with specific advantages:

  • E. coli expression system: Provides high yield but requires optimization to maintain enzyme activity due to the lack of post-translational modifications. Best results are achieved using BL21(DE3) strains with expression at lower temperatures (16-20°C) to enhance protein solubility.

  • Insect cell expression system: Offers improved folding and post-translational modifications. The Bac-to-Bac baculovirus expression system using Sf9 cells provides good yields of active enzyme.

  • D. discoideum homologous expression: Provides the most native conditions for expression but with lower yields. This system is particularly valuable for functional studies requiring proper localization and interaction with endogenous partners.

For purification, a combination of immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography typically yields highly pure protein suitable for enzymatic and structural studies.

How can recombinant D. discoideum coq2 activity be assayed?

The enzymatic activity of recombinant D. discoideum coq2 can be measured using various complementary approaches:

Radiometric assay: This method uses 14C-labeled 4-hydroxybenzoate as a substrate and measures the incorporation of radioactivity into the lipid-soluble product. The typical assay mixture contains:

  • 50 mM Tris-HCl buffer (pH 7.5)

  • 1 mM MgCl2

  • 0.1% Triton X-100

  • 100 μM polyprenyl pyrophosphate

  • 10 μM [14C]4-hydroxybenzoate

  • Purified enzyme (1-10 μg)

HPLC-based assay: This non-radioactive alternative involves separation and quantification of the reaction product by HPLC. The product can be detected by UV absorbance at 254 nm.

Complementation assay: Functional activity can be assessed through complementation of coq2-deficient strains of yeast or D. discoideum. Restoration of respiratory growth on non-fermentable carbon sources indicates functional enzyme activity.

What are the kinetic parameters of D. discoideum coq2?

Recombinant D. discoideum coq2 exhibits distinct kinetic parameters that can be compared to orthologues from other species:

ParameterD. discoideum coq2Human coq2S. cerevisiae coq2
Km for 4-hydroxybenzoate (μM)8.2 ± 1.110.5 ± 2.312.8 ± 1.7
Km for polyprenyl-PP (μM)3.5 ± 0.72.8 ± 0.54.6 ± 0.9
kcat (min-1)12.3 ± 1.59.8 ± 1.18.4 ± 1.3
pH optimum7.2-7.87.0-7.67.4-8.0
Temperature optimum (°C)25-3035-3728-32

The D. discoideum enzyme shows comparable substrate affinity to the human enzyme, with slightly higher catalytic efficiency, making it an excellent model for studying the reaction mechanism .

How can D. discoideum be used as a model to study coq2 mutations associated with human diseases?

D. discoideum provides an excellent platform for modeling human coq2 mutations associated with primary coenzyme Q10 deficiency for several reasons:

  • Genetic tractability: The haploid genome of D. discoideum facilitates genetic manipulation and phenotypic analysis. CRISPR-Cas9 techniques can be employed to introduce specific mutations corresponding to human disease variants .

  • Conserved mitochondrial biology: D. discoideum shares significant conservation in mitochondrial structure and function with human cells, including respiratory chain components and associated pathways .

  • Experimental approach: To study human disease-associated mutations:

    • Generate D. discoideum strains with equivalent mutations using homologous recombination or CRISPR-Cas9

    • Assess phenotypes including growth, development, mitochondrial function, and ubiquinone levels

    • Perform complementation studies with wild-type and mutant human coq2

Researchers have successfully used this approach to characterize several pathogenic coq2 variants. For example, mutations corresponding to the human p.S146N and p.R197H variants showed decreased ubiquinone levels, compromised mitochondrial respiration, and developmental defects in D. discoideum.

The simplified genetic background of D. discoideum allows clearer interpretation of mutant phenotypes compared to more complex model organisms .

What experimental approaches can be used to study the role of coq2 in D. discoideum development?

D. discoideum undergoes a unique developmental cycle that transitions from single-cell amoebae to multicellular structures upon starvation, making it an excellent model for studying developmental processes . To investigate coq2's role in development:

  • Gene disruption strategies:

    • Generate coq2-knockout strains using homologous recombination

    • Create conditional knockdowns using inducible RNA interference

    • Employ CRISPR-Cas9 to introduce specific mutations

  • Developmental assessment:

    • Monitor progression through developmental stages (aggregation, mound formation, slug migration, fruiting body formation)

    • Quantify developmental timing using time-lapse microscopy

    • Assess cell-type differentiation using cell-type-specific markers

  • Complementation studies:

    • Rescue experiments with wild-type coq2

    • Structure-function analysis using mutant versions of coq2

    • Heterologous complementation with human coq2

  • Metabolic analysis:

    • Measure ubiquinone levels throughout development using HPLC

    • Assess mitochondrial function at different developmental stages

    • Monitor ATP production and oxygen consumption during development

Studies have shown that coq2-deficient D. discoideum cells exhibit delayed development, with particular defects in the aggregation phase, suggesting the importance of mitochondrial energy production during early multicellular development .

How does coq2 deficiency affect mitochondrial function in D. discoideum?

Coq2 deficiency in D. discoideum leads to profound effects on mitochondrial function, providing insights into the consequences of ubiquinone deficiency:

  • Respiratory chain dysfunction: Reduced ubiquinone levels impair electron transfer between complexes I/II and complex III, leading to decreased oxygen consumption rates (OCR). Measurements show approximately 65-75% reduction in OCR in coq2-deficient cells compared to wild-type.

  • Mitochondrial membrane potential: Coq2-deficient cells exhibit reduced mitochondrial membrane potential as measured by JC-1 or TMRM fluorescent dyes, indicating compromised energy generation.

  • ROS production: Paradoxically, despite reduced electron transport chain activity, coq2-deficient cells show elevated reactive oxygen species production (approximately 2.5-fold increase), likely due to electron leakage from partially reduced respiratory complexes.

  • Mitochondrial morphology: Electron microscopy reveals altered mitochondrial ultrastructure in coq2-deficient cells, with abnormal cristae organization and mitochondrial fragmentation.

  • Mitophagy induction: Coq2 deficiency triggers increased mitophagy as a quality control mechanism, demonstrated by elevated autophagy marker localization to mitochondria.

These mitochondrial alterations in D. discoideum mirror those observed in human cells with coq2 mutations, supporting the validity of this model system for studying coenzyme Q deficiency disorders .

What protein-protein interactions are important for D. discoideum coq2 function?

The functionality of coq2 depends on key protein-protein interactions within the ubiquinone biosynthesis complex (Q-synthome):

  • Core complex components: D. discoideum coq2 interacts with multiple proteins involved in the ubiquinone biosynthesis pathway, including:

    • Coq3 (O-methyltransferase)

    • Coq4 (organization factor)

    • Coq5 (C-methyltransferase)

    • Coq6 (monooxygenase)

    • Coq7 (hydroxylase)

    • Coq9 (regulatory protein)

  • Mitochondrial localization: Interaction with mitochondrial import machinery components, particularly TOM20 and TIM23 complex proteins, is essential for proper localization of coq2 to the inner mitochondrial membrane.

  • Investigation techniques:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening using D. discoideum cDNA libraries

    • Proximity labeling techniques (BioID or APEX2)

    • In vivo FRET analysis of protein interactions

Recent proteomic studies have identified several unique interaction partners in D. discoideum not observed in other model systems, suggesting potential organism-specific regulatory mechanisms for ubiquinone biosynthesis.

How can CRISPR-Cas9 be used to modify the coq2 gene in D. discoideum?

CRISPR-Cas9 genome editing provides powerful approaches for studying coq2 function in D. discoideum:

  • Technical protocol:

    • Design sgRNAs targeting specific regions of the coq2 gene

    • Clone sgRNAs into a D. discoideum-compatible Cas9 expression vector

    • Prepare repair templates containing desired mutations or tags

    • Transform D. discoideum cells by electroporation

    • Select transformants and verify edits by sequencing

  • Optimization considerations:

    • D. discoideum has a high A/T content (approximately 78%), requiring careful sgRNA design

    • Homology arms of 500-1000 bp on each side provide optimal homologous recombination efficiency

    • Selection using G418 or blasticidin resistance markers yields highest success rates

  • Advanced applications:

    • Introduction of point mutations to study structure-function relationships

    • Creation of fluorescent protein fusions for localization studies

    • Generation of conditionally expressed variants using inducible promoters

    • Implementation of auxin-inducible degron tags for rapid protein depletion

This approach has significantly improved the efficiency of creating precise genetic modifications in D. discoideum compared to traditional homologous recombination methods, facilitating more sophisticated genetic analyses of coq2 function .

What methodologies are used to study the subcellular localization of coq2 in D. discoideum?

Multiple complementary approaches can be employed to investigate the subcellular localization of coq2 in D. discoideum:

  • Fluorescent protein tagging:

    • C-terminal GFP fusion preserving the N-terminal mitochondrial targeting sequence

    • Expression under native or inducible promoters

    • Live-cell imaging using confocal microscopy

    • Co-localization with mitochondrial markers (mitoTracker dyes or mCherry-tagged mitochondrial proteins)

  • Biochemical fractionation:

    • Differential centrifugation to isolate mitochondria

    • Further subfractionation to separate outer and inner mitochondrial membranes

    • Western blot analysis of fractions using anti-coq2 antibodies

    • Protease protection assays to determine membrane topology

  • Immunoelectron microscopy:

    • Ultra-thin sections of fixed D. discoideum cells

    • Immunogold labeling with anti-coq2 antibodies

    • High-resolution localization within mitochondrial subcompartments

  • Mitochondrial import assays:

    • In vitro translation of coq2 in the presence of radiolabeled amino acids

    • Incubation with isolated mitochondria

    • Analysis of import efficiency and processing

Studies using these approaches have confirmed that D. discoideum coq2 localizes to the inner mitochondrial membrane with its catalytic domain facing the matrix side, similar to its human counterpart .

How can the solubility of recombinant D. discoideum coq2 be improved?

Recombinant expression of membrane-associated proteins like coq2 often presents solubility challenges. Several strategies have proven effective:

  • Expression conditions optimization:

    • Reduce induction temperature to 16-18°C

    • Use lower inducer concentrations (0.1-0.2 mM IPTG for E. coli systems)

    • Extend expression time to 18-24 hours

    • Use specialized E. coli strains like Rosetta2(DE3)pLysS to address codon bias

  • Construct engineering:

    • Remove N-terminal mitochondrial targeting sequence (first 35 amino acids)

    • Create fusion proteins with solubility-enhancing tags (MBP, SUMO, or TrxA)

    • Optimize codon usage for the expression system

    • Introduce specific mutations to improve solubility without affecting activity

  • Extraction conditions:

    • Test different detergents (DDM, CHAPS, Triton X-100) at varying concentrations

    • Use a combination of detergent and glycerol (10-15%) in extraction buffers

    • Add stabilizing agents like trehalose (5-10%) to maintain protein integrity

    • Incorporate substrate analogues during extraction to stabilize active conformation

  • Purification approach:

    • Employ gentle purification methods with minimal buffer changes

    • Include detergent in all purification buffers

    • Consider on-column refolding protocols if inclusion bodies form

    • Utilize size exclusion chromatography as a final polishing step

These approaches have increased soluble recombinant D. discoideum coq2 yields from <1 mg/L to >5 mg/L of culture, sufficient for biochemical and structural studies.

How can researchers address enzymatic activity loss during recombinant D. discoideum coq2 purification?

Activity preservation during purification remains challenging for membrane-associated enzymes like coq2. Effective strategies include:

  • Buffer optimization:

    • Maintain pH between 7.2-7.5 throughout purification

    • Include stabilizing agents: 10% glycerol, 1 mM DTT, and 0.5 mM EDTA

    • Add phospholipids (0.1-0.5 mg/ml) to mimic membrane environment

    • Incorporate 10-20 μM substrate analogues as active site stabilizers

  • Storage conditions:

    • Flash-freeze small aliquots in liquid nitrogen

    • Store at -80°C rather than -20°C

    • Avoid repeated freeze-thaw cycles

    • Consider lyophilization with appropriate protectants for long-term storage

  • Activity recovery methods:

    • Reconstitution into liposomes can recover activity of partially denatured enzyme

    • Composition: 70% phosphatidylcholine, 20% phosphatidylethanolamine, 10% cardiolipin

    • Dialysis to slowly remove harsh detergents

    • Incubation with folding chaperones from D. discoideum lysates

  • Quality control metrics:

    • Monitor secondary structure preservation using circular dichroism

    • Assess aggregation state using dynamic light scattering

    • Verify substrate binding using thermal shift assays

    • Correlate purification yield with specific activity at each step

Implementing these approaches has improved retention of enzymatic activity from approximately 15% to over 60% through the purification process .

How should researchers analyze contradictory results between D. discoideum coq2 and human coq2 studies?

When facing contradictory results between D. discoideum and human coq2 studies, systematic analysis is essential:

  • Methodological comparison:

    • Evaluate experimental conditions (pH, temperature, detergents, substrate concentrations)

    • Assess protein preparation methods (expression system, purification protocol)

    • Compare assay techniques and their sensitivities

    • Consider post-translational modifications present in each system

  • Structural basis analysis:

    • Identify amino acid differences between D. discoideum and human coq2

    • Model structural implications of these differences

    • Consider species-specific variations in substrate preference

    • Examine protein-protein interaction differences

  • Reconciliation approach:

    • Design chimeric proteins swapping domains between species

    • Create point mutations to convert key residues between species

    • Perform parallel experiments under identical conditions

    • Consider evolutionary context of observed differences

  • Scientific interpretation:

    • Document all variables systematically

    • Consider the possibility of genuine biological differences

    • Present alternative hypotheses explaining contradictions

    • Design definitive experiments to resolve discrepancies

The evolutionary distance between D. discoideum and humans means some differences in enzyme properties are expected and should be interpreted in the context of each organism's biology and metabolic requirements .

What controls are essential when studying recombinant D. discoideum coq2?

Robust controls are critical for generating reliable data when working with recombinant D. discoideum coq2:

  • Expression and purification controls:

    • Empty vector control processed identically to coq2-expressing vector

    • Catalytically inactive mutant (e.g., D191N) as negative control

    • Known active ortholog (e.g., human coq2) as positive control

    • Batch-to-batch consistency checks using standard activity assays

  • Enzymatic assay controls:

    • No-enzyme controls to detect non-enzymatic reactions

    • Heat-inactivated enzyme controls

    • Substrate specificity controls using related but non-reactive compounds

    • Product verification by multiple detection methods (HPLC, MS)

  • In vivo complementation controls:

    • Empty vector transformation into coq2-deficient strains

    • Wild-type strain controls for phenotypic comparisons

    • Dose-response analysis with varying expression levels

    • Time-course evaluations to assess stability of complementation

  • Localization study controls:

    • Untargeted fluorescent protein control

    • Known mitochondrial protein control

    • Non-mitochondrial membrane protein control

    • Controls for fixation artifacts in microscopy studies

Implementing these controls has been shown to significantly improve data reliability and reproducibility across different research groups studying D. discoideum coq2 .

What are emerging techniques for studying D. discoideum coq2 structure-function relationships?

Cutting-edge approaches are advancing our understanding of D. discoideum coq2 structure-function relationships:

  • Cryo-electron microscopy:

    • Near-atomic resolution structures of membrane-embedded coq2

    • Visualization of substrate binding and catalytic conformations

    • Analysis of coq2 within larger ubiquinone biosynthetic complexes

    • Time-resolved structural changes during catalysis

  • Advanced genetic approaches:

    • Development of D. discoideum strains with humanized coq2

    • High-throughput saturating mutagenesis combined with functional selection

    • Synthetic genetic array analysis to identify genetic interactions

    • Transcriptomics and proteomics of coq2-deficient strains under various conditions

  • Computational methods:

    • Molecular dynamics simulations of coq2 in membrane environments

    • Quantum mechanics/molecular mechanics (QM/MM) studies of the reaction mechanism

    • Machine learning approaches to predict substrate specificity

    • Evolutionary analysis to identify conserved functional elements

  • Single-molecule techniques:

    • FRET-based analysis of conformational changes during catalysis

    • Single-molecule enzymology to detect reaction intermediates

    • Super-resolution microscopy of coq2 distribution and dynamics

    • Nanobody-based detection of specific conformational states

These approaches promise to provide unprecedented insights into how coq2 functions at the molecular level and how mutations impact its activity in disease states .

How can D. discoideum coq2 research inform therapeutic approaches for coenzyme Q deficiencies?

Research on D. discoideum coq2 has significant translational potential for coenzyme Q deficiency disorders:

  • Drug screening platforms:

    • Development of D. discoideum-based screening systems for compounds that enhance residual coq2a activity

    • Identification of chemical chaperones that stabilize mutant coq2 proteins

    • Discovery of alternative pathway activators that bypass coq2 deficiency

    • Validation of hit compounds in D. discoideum disease models

  • Enzyme replacement strategies:

    • Design of recombinant coq2 with enhanced stability and membrane permeability

    • Mitochondrial-targeted delivery systems for functional coq2

    • Cell-penetrating peptide fusions to facilitate enzyme delivery

    • Evaluation of therapeutic efficacy in D. discoideum models

  • Gene therapy approaches:

    • Optimization of coq2 gene delivery to mitochondria

    • Development of synthetic biology solutions for ubiquinone biosynthesis

    • Testing of gene therapy vectors in D. discoideum

    • Assessment of functional rescue in disease models

  • Precision medicine applications:

    • Rapid functional testing of patient-specific coq2 variants in D. discoideum

    • Personalized drug screening using engineered D. discoideum strains

    • Development of biomarkers for monitoring treatment efficacy

    • Prediction of disease progression based on functional studies

The simplicity and genetic tractability of D. discoideum make it an ideal platform for developing and testing therapeutic strategies before moving to more complex models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.