Recombinant Dictyostelium discoideum ABC transporter B family member 5 (abcB5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
abcB5; DDB_G0292554; ABC transporter B family member 5; ABC transporter ABCB.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-697
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcB5
Target Protein Sequence
MYSINRIGIHGISNKILSRPKFFHSSSSIFSLNQNLNNFKNNNNYILNGYNKITHNHHHQ TLFHRHYSNLKQEQENKQQNVGKNSETSPSSTTTTENITTATTATTKTDIKETQNSTMSM LKTVFKYLWPKDNNDSKIRIITSVLLLLSAKVLTVQIPFIFKDIVDSLTTTQSEMLTLPL GLLLAYGAVKITSNGFQELRQTIFSKVAHDAIRDVSCSTFKRLHQLDLTFHLSRQTGSLS RIIDRGGRGINFLLNSILFHVVPTAFEISLVSYVMYTTLGWEYSALSLATIAAYTVFTVK VTKWRTQFRVKMNKMDNEASNKMMDSLINFETVKYFNNDALEVERYHNYLKEYDKASLKT TSSLSFLNFGQALIFSLSMTAMMIMAAQGVVQGNLSVGDLVLVNGLLFQISLPLNFLGTV YREIKQSLVDMDHLFSLLNLNPKISDNKDSKPLKLENGTIVFRDISFKYNDSVQVLNNVS FECEGGKRIAIVGSSGSGKSTLLRLLYRFYDVSSGSIEIDGQDIRGIQLESLRKHIGVVP QDTVLFNDTIYYNIAYGNPNATKEQVENAARAAHIHEVILNMKNGYDTVVGERGLKLSGG EKQRVSIARAILKDSPIVFYDEATSSLDTEKEKLIMDALRELFKGRTTIMIAHRLSTIVD ADEIIVLGTGGIILERGNHQQLLELEGKYRSMWLAQQ
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCB family, Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is abcB5 and what is its role in Dictyostelium discoideum?

abcB5 is a member of the ATP-binding cassette (ABC) transporter B family in Dictyostelium discoideum. It functions as a transmembrane transporter that uses ATP hydrolysis to move various molecules across cellular membranes . ABC transporters in D. discoideum are involved in various cellular processes, including development and potentially drug resistance. The protein is encoded by the abcB5 gene and cataloged with Uniprot number Q8T9W2 . While the specific molecules transported by abcB5 have not been fully characterized, research on ABC transporters in general suggests they play crucial roles in cellular detoxification, nutrient transport, and signaling molecule secretion.

In experimental settings, researchers should approach abcB5 characterization through knockout studies, transcriptional analysis, and protein localization experiments to better understand its physiological role, similar to methods used for other ABC transporters in D. discoideum .

What detection methods can be used to study abcB5 in experimental systems?

Several detection methods can be employed to study abcB5 in experimental systems:

  • Immunoblotting/Western blotting: Utilizing the His-tag on the recombinant protein, anti-His antibodies can detect the protein in cell lysates or purified samples . Researchers can separate proteins by SDS-PAGE, transfer to membranes, and probe with appropriate antibodies.

  • Immunofluorescence microscopy: For cellular localization studies, researchers can use either antibodies against the His-tag or specific antibodies against abcB5, if available . The general protocol involves fixing cells with 4% paraformaldehyde, permeabilizing with methanol at -20°C, blocking with PBS + 0.2% BSA, and incubating with primary antibodies followed by fluorescently labeled secondary antibodies .

  • RNA-seq or RT-PCR: For gene expression analysis, these techniques can track abcB5 transcript levels under different conditions or in mutant strains . Validation of insertion mutations can be verified through RNA-seq by confirming modified expression of the abcB5 gene.

  • Mass spectrometry: For protein identification and post-translational modification analysis in complex samples.

Methodologically, when designing experiments to detect abcB5, researchers should include appropriate controls and consider the cellular context to ensure accurate interpretation of results.

How can I establish and validate an abcB5 knockout strain in Dictyostelium discoideum?

Creating and validating an abcB5 knockout strain requires a systematic approach:

Method for gene disruption:

  • Use homologous recombination in the parental AX4 strain following established protocols for D. discoideum .

  • Construct DNA vectors using either transposon mutagenesis or direct cloning methods targeting the abcB5 gene .

  • Design constructs to insert into exons rather than introns when possible, as intronic insertions might result in partial expression (as observed with atabcg25-1 in Arabidopsis) .

Validation protocol:

  • Genomic verification: Perform PCR on genomic DNA to confirm insertion at the targeted site .

  • Transcriptional verification: Use RT-PCR or RNA-seq to confirm absence of abcB5 transcripts in the mutant strain .

  • Phenotypic analysis: Examine both morphological and transcriptional phenotypes during growth and development phases .

Data interpretation table:

Validation MethodExpected Result in KnockoutPotential ComplicationSolution
Genomic PCRBands corresponding to insertion junctionsMultiple insertionsUse Southern blotting for confirmation
RT-PCRNo abcB5 transcriptFaint bands indicating partial expressionRedesign insertion to target exons
RNA-seqSignificant reduction in abcB5 readsCompensatory upregulation of other transportersAnalyze entire ABC transporter family expression
Phenotypic analysisMay show subtle morphological changesRedundant functions masking phenotypeExamine under stress conditions or create double mutants

When interpreting knockout validation data, remember that ABC transporter mutants often exhibit subtle morphological phenotypes, making transcriptional phenotypes particularly valuable for functional characterization .

How does abcB5 compare functionally with other ABC transporters in Dictyostelium discoideum?

The ABC transporter family in Dictyostelium discoideum includes multiple members with diverse functions. Comparing abcB5 with other family members provides insights into its specific role:

Functional comparison:

While specific functions of abcB5 have not been fully elucidated in the provided sources, systematic studies of ABC transporter mutants in D. discoideum have revealed that:

  • Most ABC transporter mutants, including likely abcB5 mutants, show subtle morphological phenotypes, suggesting potential functional redundancy within the family .

  • Transcriptional phenotyping can reveal functional groupings among ABC transporters that may not be apparent from morphological analysis alone .

  • Some ABC transporters like abcG6 and abcG18 have been implicated in intercellular signaling during terminal differentiation of spores and stalks .

Methodological approach for comparative analysis:

  • Create single and double knockouts of abcB5 and related transporters

  • Perform transcriptome analysis under various conditions

  • Conduct subcellular localization studies

  • Test substrate specificity using transport assays

Researchers should design experiments that challenge cells with various stressors or conditions to reveal functional differences between abcB5 and other ABC transporters. For instance, based on knowledge from human ABCB5, testing drug resistance phenotypes could be informative as ABCB5 functions as an energy-dependent efflux transporter responsible for decreased drug accumulation in multidrug-resistant cells .

What role might abcB5 play in Dictyostelium discoideum development and multicellularity?

Given that Dictyostelium discoideum can transition between unicellular and multicellular forms, investigating abcB5's role in development provides insights into evolutionary transitions:

Potential developmental roles:

  • Intercellular signaling during aggregation or differentiation phases

  • Transport of developmental signals or morphogens

  • Cellular detoxification during developmental stress

While specific evidence for abcB5's role in development is limited in the provided sources, research on other ABC transporters in D. discoideum suggests potential developmental functions. For instance, abcG6 and abcG18 influence spore differentiation during final stages of development .

Methodological approach to investigate developmental roles:

  • Monitor abcB5 expression patterns throughout the developmental cycle using RT-PCR, RNA-seq, or reporter constructs

  • Examine developmental phenotypes of abcB5 knockout strains under various conditions

  • Identify potential transported substrates that may be involved in development

  • Perform transcriptome analysis comparing wild-type and abcB5 knockout strains during key developmental transitions

When designing these experiments, researchers should consider that developmental phenotypes may only manifest under specific conditions, such as nutrient limitation or other stressors that trigger the multicellular developmental program in D. discoideum .

What are the optimal conditions for storing and handling recombinant abcB5?

Proper storage and handling of recombinant abcB5 is crucial for maintaining protein integrity and experimental reproducibility:

Storage recommendations:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Liquid form has a shelf life of approximately 6 months at -20°C/-80°C

  • Lyophilized form remains stable for up to 12 months at -20°C/-80°C

Handling protocols:

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Store working aliquots at 4°C for up to one week to minimize freeze-thaw damage

  • When using for experiments, thaw samples on ice and centrifuge briefly before opening tubes to collect all material

  • Consider adding protease inhibitors when working with the protein in solution

Storage buffer considerations:
While specific buffer recommendations for abcB5 are not provided in the sources, transmembrane proteins generally benefit from buffers containing low concentrations of detergents to maintain solubility and prevent aggregation. Researchers should optimize buffer conditions based on downstream applications.

These handling procedures should be documented meticulously in laboratory protocols to ensure experimental reproducibility and optimal protein performance.

How can I develop or select antibodies for detecting native and recombinant abcB5?

Developing effective antibodies for abcB5 detection requires careful consideration:

Antibody development options:

Antibody validation protocol:

  • Test antibody specificity via Western blotting using wild-type and knockout strains

  • Verify cellular localization patterns using immunofluorescence microscopy

  • Perform immunoprecipitation followed by mass spectrometry to confirm target identity

  • Include appropriate controls in all experiments (isotype controls, secondary-only controls)

Immunofluorescence method for D. discoideum:

  • Settle 5 × 10^5 cells on glass coverslips for 90 min

  • Fix with 4% paraformaldehyde for 30 min

  • Block with PBS + 40 mM ammonium chloride for 5 min

  • Permeabilize with cold methanol (-20°C) for 2 min

  • Block with PBS + 0.2% BSA

  • Incubate with primary antibody, wash, then incubate with fluorescently-labeled secondary antibody

  • Mount and visualize using confocal microscopy

When selecting between different antibody formats, researchers should consider the specific application needs and experimental conditions to optimize detection sensitivity and specificity.

What are the challenges in purifying active abcB5 for functional studies?

Purifying membrane proteins like abcB5 presents several challenges that researchers must address:

Key challenges and solutions:

ChallengeDescriptionMethodological Solution
Membrane protein solubilizationExtracting protein from membranes without denaturationUse mild detergents (DDM, LMNG, or digitonin); test detergent screening panels to identify optimal conditions
Maintaining native conformationPreserving protein structure during purificationInclude appropriate lipids in purification buffers; consider nanodiscs or amphipols for stabilization
ATPase activity preservationEnsuring functional ATP binding and hydrolysisAdd ATP/ADP analogs during purification; avoid metal chelators that might strip essential ions
Aggregation preventionPreventing protein precipitationOptimize buffer conditions (pH, salt, additives); use size exclusion chromatography as final purification step
Yield optimizationObtaining sufficient quantities for experimentsOptimize expression conditions; consider fusion partners that enhance expression

Purification strategy:

  • Exploit the N-terminal 10xHis-tag for initial purification using immobilized metal affinity chromatography (IMAC)

  • Follow with size exclusion chromatography to remove aggregates and obtain homogeneous preparation

  • Verify protein integrity by SDS-PAGE and Western blotting

  • Assess functional activity through ATPase assays

For functional studies, researchers should verify that the purified protein retains ATPase activity, which is essential for ABC transporter function. Developing a robust activity assay is critical for interpreting structure-function studies and drug screening experiments.

How do findings from human ABCB5 studies inform research on Dictyostelium discoideum abcB5?

Research on human ABCB5 provides valuable insights that can guide investigations of D. discoideum abcB5:

Functional parallels:
Human ABCB5 functions as an energy-dependent efflux transporter responsible for decreased drug accumulation in multidrug-resistant cells . This suggests that D. discoideum abcB5 might play similar roles in cellular detoxification and drug resistance.

Experimental approaches to adapt:

  • Drug resistance assays: Test D. discoideum abcB5 knockout strains for altered sensitivity to various compounds, similar to studies showing that human ABCB5 expression in Saccharomyces cerevisiae confers drug resistance .

  • Transport substrate identification: Screen potential transported molecules based on known human ABCB5 substrates.

  • Structure-function analysis: Use information about critical domains and residues in human ABCB5 to guide mutagenesis studies in the D. discoideum protein.

Evolutionary considerations:
When interpreting data across species, researchers should be mindful that despite functional similarities, the specific substrates and regulatory mechanisms may have diverged. Therefore, hypotheses derived from human ABCB5 studies should be experimentally verified in the D. discoideum system.

Methodologically, comparative genomics and sequence analysis tools can help identify conserved domains between human and D. discoideum ABC transporters, guiding targeted functional studies.

What transcriptomic approaches can reveal abcB5 function in different developmental stages?

Transcriptomic analysis offers powerful insights into abcB5 function across D. discoideum's life cycle:

Recommended transcriptomic approaches:

  • Developmental time-course RNA-seq: Sample cells at multiple time points during development (0, 4, 8, 12, 16, 20, 24 hours) in both wild-type and abcB5 knockout strains to identify genes with altered expression patterns .

  • Conditional expression systems: Combine with RNA-seq to identify immediate gene expression changes following abcB5 induction or repression.

  • Single-cell RNA-seq: Particularly valuable during multicellular development stages to identify cell-type specific roles of abcB5.

  • Comparative analysis with other ABC transporter mutants: Generate a transcriptional profile matrix to identify genes consistently affected across mutants .

Data analysis strategy:

  • Identify differentially expressed genes (DEGs) between wild-type and knockout strains

  • Perform gene ontology (GO) enrichment analysis on DEGs

  • Look for temporal patterns in gene expression changes

  • Identify potential gene regulatory networks affected by abcB5 loss

From previous studies on ABC transporters in D. discoideum, researchers found that despite subtle morphological phenotypes, transcriptional profiling revealed more pronounced effects that allowed functional grouping of transporters . This suggests that transcriptomic approaches are particularly valuable for characterizing abcB5 function.

How can systems biology approaches integrate abcB5 into the broader context of Dictyostelium discoideum biology?

Integrating abcB5 research into systems biology approaches provides a comprehensive understanding of its role:

Systems biology strategies:

  • Protein-protein interaction network analysis: Identify binding partners of abcB5 using techniques such as affinity purification-mass spectrometry or yeast two-hybrid screens.

  • Metabolomic profiling: Compare metabolite levels between wild-type and abcB5 knockout strains to identify potential transported substrates or affected metabolic pathways.

  • Multi-omics data integration: Combine transcriptomic, proteomic, and metabolomic data to develop predictive models of abcB5 function.

  • Comparative analysis across developmental stages: Systems-level comparisons between unicellular and multicellular phases may reveal stage-specific functions, especially relevant given D. discoideum's position at the evolutionary crossroads between uni- and multicellularity .

Network analysis approach:
Based on research on other ABC transporters in D. discoideum, systematic study of mutant phenotypes combined with transcriptional profiling can identify sets of genes that are consistently affected across conditions . For abcB5, this approach could reveal:

  • Core processes affected by abcB5 function

  • Compensatory mechanisms activated in abcB5 mutants

  • Condition-specific roles of abcB5

When designing systems biology experiments, researchers should consider both temporal dynamics (development stages) and spatial considerations (subcellular localization) to fully characterize abcB5's functional context.

What are the most promising future research directions for Dictyostelium discoideum abcB5?

Based on current knowledge and research trends, several promising directions emerge for future abcB5 research:

  • Substrate identification: Determining the specific molecules transported by abcB5 would significantly advance understanding of its cellular function. Approaches combining genetics, biochemistry, and metabolomics show particular promise.

  • Developmental regulation: Investigating how abcB5 expression and activity are regulated during the transition from unicellular to multicellular forms could provide insights into evolutionary aspects of multicellularity .

  • Structural biology: Determining the three-dimensional structure of abcB5 would enable structure-based drug design and detailed mechanistic studies of transport function.

  • Comparative analysis with pathogens: As ABC transporters often contribute to drug resistance, comparative studies between D. discoideum abcB5 and transporters in pathogenic organisms could reveal new therapeutic targets.

  • Development of abcB5-specific tools: Creating specific inhibitors, activators, or biosensors for abcB5 would facilitate more detailed functional studies.

The relatively small size of the D. discoideum research community presents both challenges and opportunities . While commercial resources may be limited, collaborative approaches and open sharing of reagents and methodologies can accelerate research progress. The continued development of recombinant tools and antibodies specific to D. discoideum proteins will be essential for advancing abcB5 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.