Recombinant Dictyostelium discoideum ABC transporter D family member 1 (abcD1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Dictyostelium discoideum ABC Transporter D Family Member 1 (abcD1)

Recombinant Dictyostelium discoideum ABC transporter D family member 1 (abcD1) is a heterologously expressed protein belonging to the ATP-binding cassette (ABC) transporter superfamily. ABC transporters are integral membrane proteins that hydrolyze ATP to transport substrates across cellular membranes. The abcD1 gene (UniProt ID: Q54W19) encodes a peroxisomal ABC transporter involved in lipid metabolism and cellular detoxification . Recombinant abcD1 is produced in expression systems such as E. coli, yeast, or mammalian cells, with purities exceeding 85–90% .

Gene and Protein Architecture

  • Gene: The abcD1 gene (DDB_G0279917) is part of the ABCD subfamily, which includes half-transporters requiring dimerization for functionality .

  • Protein: The full-length abcD1 protein comprises 734 amino acids, featuring:

    • A nucleotide-binding domain (NBD) with Walker A/B motifs for ATP hydrolysis.

    • A transmembrane domain (TMD) with six α-helical segments for substrate translocation .

    • A conserved ABC signature motif (LSGGQ) critical for ATPase activity .

Key Functional Domains

DomainSequence MotifRole
Walker AGKSTVLxLIxRFYDPATP binding
Walker BDEPSSYLDVKQRLKAAQVLRSLLATP hydrolysis
ABC signatureLSGGQCoupling ATPase to transport
Data derived from structural analyses of ABC transporters in Dictyostelium .

Production and Purification

Recombinant abcD1 is typically expressed in E. coli with an N-terminal His-tag for affinity purification . Key specifications include:

ParameterDetail
Host SystemE. coli (BL21 or similar strains)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water; 0.1–1.0 mg/mL with 50% glycerol for stability

Research Applications

Recombinant abcD1 is utilized in:

  • Functional Studies: Investigating peroxisomal fatty acid transport and metabolic regulation .

  • Disease Modeling: ABC transporters are linked to lipid storage disorders (e.g., X-linked adrenoleukodystrophy in humans) .

  • Biochemical Assays: SDS-PAGE, Western blotting, and immunogen production .

Transcriptional and Phenotypic Insights

While abcD1 itself has not been extensively characterized in mutant studies, analyses of related ABC transporters in Dictyostelium reveal:

  • Subtle Morphological Phenotypes: Most ABC transporter knockouts show minor developmental defects, suggesting functional redundancy .

  • Transcriptional Profiling: ABC transporters like abcG6 and abcG18 influence spore differentiation, highlighting roles in intercellular signaling .

Evolutionary Context

The Dictyostelium genome encodes 68 ABC transporters, reflecting evolutionary expansion from a common ancestor with bacteria . ABC subfamilies (ABCA–ABCH) in Dictyostelium show conserved motifs shared with humans and plants, underscoring their ancient origin .

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles among ABCD transporters complicate single-gene studies .

  • Substrate Specificity: The physiological cargo of abcD1 remains unidentified, necessitating lipid-binding assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
abcD1; DDB_G0279917; ABC transporter D family member 1; ABC transporter ABCD.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-734
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
Target Protein Sequence
MKTTNVKNNNNNINNTDEEIKIKNNYNQNDERLKKIKENKFDWALFKRFINIIKILYAKP VIPLTLFLILFGNGFAQTYVSKFTGILLADIYASFTSGDKVFFLSSVLKAGFAIGGSALL AAIINFIVSIMAWNWRKTLCLYIQNVYFKKSLFYKILAFDDRIDNPDQRITSDIDNFTTL LASIVSQCITGPMVVVYYTYLCYTTIDWYAPLIVYGFFFLGYLINKLVMSPMVSINYLQD KLEGDFRSLHQRIRNFSESIALYSLSKEKQHPEKRFDNNDYDHGYESDDSDQSCDESTTI INRKKNKGSQYYKNKNSTSKKINDFIDKLSGDSNDQKEELLVEEEQAKIQFEALLKNKKR VIFWQLGLNTTSDLFTYLSPIANYFIIAIPVFFLNNKSVLQPGDVTVQSYNCIMLASGFS QYINVSQSISDLSGYISRISSMIEVCKKIMEDVSLDADITKLNEKVAQTHNNDAIINTGS SGNISLNNGDSITLDDVTYFTPKGNQLYSKISINVKRGNNLLIMGPSGSGKSSLIRIING LWPFFKGSIDRPENGDMFFLPQQPYLIFGTLEEQILYPFSKKQKRIPKSIMRELFQRFEI DYLLDRERFIKKSAQVNDLTHNWLNQLSPGEQQLIAIIRLIYHKPKFALMDESTSSIPQS LEERVYYVAKELGITIISVGHRISLLKYHSTLLRFDKDKNWYLEDIINQNNQSNNINNNN NNNTNKIAEDSVFD
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Dictyostelium discoideum ABC transporter D family member 1 (abcD1)?

The abcD1 protein is a member of the ATP-binding cassette (ABC) transporter superfamily found in the social amoeba Dictyostelium discoideum. ABC transporters constitute one of the largest gene families in both bacterial and eukaryotic genomes, characterized by a conserved 200-250 amino acid ATP-binding cassette domain . In D. discoideum specifically, the abcD1 protein (Q54W19) consists of 734 amino acids and contains the characteristic ATP-binding domains with the conserved LSGG sequence between the Walker A and B motifs essential for ABC transporter function . The protein is involved in transmembrane transport processes, likely participating in the export of specific molecules across cellular membranes as part of the organism's complex metabolism.

How does abcD1 from D. discoideum compare to human ABCD1?

Human ABCD1 and D. discoideum abcD1 share functional similarities despite evolutionary distance. In humans, ABCD1 mutations cause adrenoleukodystrophy (ALD), as the protein normally facilitates the breakdown of very long chain fatty acids (VLCFAs) . The D. discoideum ortholog likely serves a similar biochemical function in fatty acid metabolism, though in the context of the amoeba's unique physiology. Both proteins contain the signature ATP-binding cassette domains and transmembrane regions typical of ABC transporters . The amino acid sequence of D. discoideum abcD1 reveals the expected structural elements: transmembrane domains that anchor the protein in the membrane and nucleotide-binding domains that harness ATP energy for substrate transport . This structural conservation makes D. discoideum a potentially valuable model organism for studying fundamental aspects of ABCD transporter biology relevant to human disease.

What is known about the expression patterns of abcD1 in D. discoideum?

The expression of abcD1 in D. discoideum varies during different life cycle stages and in response to environmental stimuli. While specific expression data for abcD1 is not detailed in the provided search results, transcriptomic studies of D. discoideum have demonstrated that the organism significantly modifies its gene expression patterns when exposed to different bacterial species . For instance, bacteria such as Bacillus subtilis, Klebsiella pneumoniae, and Mycobacterium marinum each induce specific and distinct transcriptional responses in D. discoideum . Given that ABC transporters play crucial roles in cellular defense and molecular export, abcD1 expression may be regulated as part of these bacterial response pathways. During the transition from unicellular to multicellular forms, D. discoideum undergoes substantial transcriptomic changes, which likely include regulation of ABC transporters involved in signaling and metabolite transport during development.

What are the recommended conditions for handling recombinant D. discoideum abcD1 protein?

For optimal handling of recombinant D. discoideum abcD1 protein, researchers should follow specific storage and reconstitution protocols. The recombinant protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For storage:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Aliquot and store at -20°C/-80°C

The reconstituted protein is stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Repeated freezing and thawing should be avoided as it may compromise protein integrity and activity.

How can researchers express and purify recombinant D. discoideum abcD1 for functional studies?

Based on current methodologies for recombinant ABC transporters, researchers can express and purify D. discoideum abcD1 using the following approach:

  • Expression System Selection: The protein is commonly expressed in E. coli as evidenced by the commercially available recombinant protein . For functional studies requiring proper folding and post-translational modifications, researchers might consider alternative expression systems such as yeast or insect cells.

  • Construct Design:

    • The full-length protein (1-734 amino acids) with an N-terminal His-tag has been successfully expressed

    • The coding sequence should be optimized for the chosen expression system

    • Include appropriate purification tags (His-tag is common) and restriction sites

  • Purification Protocol:

    • Lyse cells in appropriate buffer conditions

    • Perform affinity chromatography using the His-tag

    • Consider additional purification steps such as ion exchange or size exclusion chromatography

    • Assess purity by SDS-PAGE (aim for >90% purity)

  • Functional Validation:

    • Verify protein identity by western blot or mass spectrometry

    • Assess ATP binding and hydrolysis activity using standard ATPase assays

    • For transport studies, consider reconstitution into liposomes or membrane vesicles

This methodology draws on established techniques for ABC transporter purification while addressing the specific properties of the D. discoideum abcD1 protein.

What cell culture conditions are optimal for D. discoideum when studying abcD1 function?

For studying abcD1 function in D. discoideum, researchers should maintain the following culture conditions:

  • Growth Medium: D. discoideum cells (such as the DH1 strain) are typically cultured in HL5c medium at 21°C . This axenic medium supports growth without bacteria.

  • Maintenance Protocol:

    • Subculture twice weekly to maintain cell density below 10^6 cells/mL

    • Culture in shaking flasks or plates depending on experimental requirements

    • Monitor for contamination regularly

  • Experimental Conditions: For studying abcD1 response to different stimuli:

    • Bacterial challenge: Various bacteria (K. pneumoniae, B. subtilis, M. luteus, M. marinum) can be grown overnight in LB medium at 37°C before introducing to D. discoideum cultures

    • For developmental studies: induce development by removing nutrients and placing cells on non-nutrient agar

    • For slug migration assays: monitor distance traveled by slugs after aggregation

  • Monitoring Parameters:

    • Cell density using hemocytometer or automated cell counter

    • Cell morphology and behavior using light microscopy

    • Growth rate by measuring doubling time

    • Cell viability using appropriate staining methods

These conditions provide the foundation for investigating abcD1 function in various physiological contexts, including growth, development, and response to bacteria.

How does abcD1 function within the context of D. discoideum's extensive ABC transporter network?

The D. discoideum genome encodes approximately 68 ABC transporter genes, representing a diverse superfamily organized into seven different families based on sequence homology, domain topology, and function . abcD1 functions within this extensive network as a member of the D subfamily, which typically includes transporters associated with peroxisomal membranes and fatty acid metabolism.

The evolutionary analysis of ABC transporters in D. discoideum suggests that many genes present in the ancestor of crown organisms (animals, plants, fungi, and Dictyostelium) underwent differential duplication and loss across phyla . Within this evolutionary context, abcD1 represents one of the conserved transporters that likely maintains essential cellular functions.

Functional relationships within the ABC transporter network can be visualized through the following table:

ABC SubfamilyTypical FunctionNotable Features in D. discoideumRelation to abcD1
ABCALipid transportPresent in D. discoideum genomeDistinct function from abcD1
ABCBMultidrug resistanceMultiple members in D. discoideumFunctionally distinct, similar ATP-binding mechanism
ABCCDrug resistance, ion transportPresent in expanded numbersShares core ABC structure with abcD1
ABCDFatty acid metabolismIncludes abcD1Primary family of interest
ABCE/ABCFLack transmembrane domains, protein synthesisPresent in D. discoideumStructurally distinct from abcD1
ABCGDiverse substrate transportMultiple members in D. discoideumDifferent domain arrangement from abcD1

This diverse ABC transporter network allows D. discoideum to manage its complex metabolism and respond to environmental challenges, with abcD1 playing a specialized role in this system .

What is known about the role of abcD1 in D. discoideum's response to different bacterial species?

While specific data on abcD1's role in bacterial response is not detailed in the provided search results, we can infer its potential involvement based on D. discoideum's transcriptional adaptation to different bacteria. D. discoideum amoebae respond with highly specific, almost non-overlapping transcriptional profiles when exposed to different bacterial species .

For example:

  • Bacillus subtilis, Klebsiella pneumoniae, and Mycobacterium marinum each induce distinct transcriptional responses

  • Micrococcus luteus triggers minimal gene regulation

  • Folate, though proposed as a key molecule secreted by bacteria and recognized by hunting amoebae, elicits a very specific and restricted transcriptional signature distinct from any bacterial response

As an ABC transporter potentially involved in metabolite export or detoxification, abcD1 may be differentially regulated in response to specific bacterial challenges. Its expression pattern might correlate with the specialized mechanisms D. discoideum employs for ingesting and killing different bacteria, which have been shown to rely on largely different molecular mechanisms .

Future research directions could include:

  • Transcriptomic analysis specifically tracking abcD1 expression during exposure to different bacteria

  • Creating abcD1 knockout strains to assess changes in bacterial response

  • Comparative analysis of abcD1 function across different D. discoideum strains with varying bacterial resistance profiles

How can D. discoideum abcD1 be used as a model for studying human ABCD1-related disorders?

D. discoideum abcD1 offers valuable research opportunities for modeling human ABCD1-related disorders such as adrenoleukodystrophy (ALD). While D. discoideum is evolutionarily distant from humans, it has retained more of the diversity of the ancestral genome than either animals or fungi , potentially preserving important functional aspects of ABCD transporters.

Methodological approaches for using D. discoideum abcD1 as a disease model include:

  • Comparative Functional Analysis:

    • Express human ABCD1 and D. discoideum abcD1 in the same cellular background

    • Compare substrate specificity and transport kinetics

    • Assess functional complementation between orthologs

  • Disease Mutation Modeling:

    • Introduce mutations corresponding to human ALD-causing mutations into D. discoideum abcD1

    • Analyze effects on protein localization, stability, and function

    • Measure accumulation of very long chain fatty acids (VLCFAs)

  • Drug Screening Platform:

    • Develop high-throughput assays using D. discoideum expressing variant forms of abcD1

    • Screen for compounds that restore normal function to mutant transporters

    • Validate hits in mammalian cell models of ABCD1 dysfunction

  • Metabolic Pathway Analysis:

    • Map the metabolic pathways affected by abcD1 dysfunction in D. discoideum

    • Compare with known pathophysiology of human ABCD1 disorders

    • Identify conserved and divergent aspects of VLCFA metabolism

This approach leverages the experimental advantages of D. discoideum (rapid growth, genetic tractability, well-characterized genome) while providing insights relevant to human disease mechanisms .

What are common challenges in expressing recombinant D. discoideum abcD1 and how can they be addressed?

Researchers working with recombinant D. discoideum abcD1 commonly encounter several technical challenges that can be systematically addressed:

  • Protein Solubility Issues:

    • Challenge: ABC transporters are membrane proteins that often aggregate when overexpressed

    • Solution: Optimize expression conditions (temperature, induction time, concentration of inducer)

    • Alternative Approach: Express individual domains separately or use fusion partners that enhance solubility

  • Proper Folding in Heterologous Systems:

    • Challenge: E. coli may not provide the proper environment for folding eukaryotic membrane proteins

    • Solution: Consider expression in eukaryotic systems like yeast, insect cells, or cell-free systems

    • Validation Method: Assess protein functionality through ATPase activity assays

  • Purification Difficulties:

    • Challenge: Membrane proteins can be difficult to extract and purify while maintaining native conformation

    • Solution: Use mild detergents for extraction; implement gradient purification strategies

    • Protocol Modification: Consider non-denaturing purification methods to preserve structure

  • Protein Stability During Storage:

    • Challenge: Recombinant abcD1 may lose activity during storage

    • Solution: Store with glycerol (5-50%) as recommended; maintain at appropriate temperature (-20°C/-80°C)

    • Quality Control: Perform activity assays before experiments to confirm protein functionality

  • Functional Reconstitution:

    • Challenge: Demonstrating transport activity in vitro

    • Solution: Reconstitute purified protein in liposomes with appropriate lipid composition

    • Experimental Design: Include positive controls with well-characterized ABC transporters

These methodological considerations are based on standard practices for working with recombinant ABC transporters and the specific information available for D. discoideum abcD1 .

How can researchers assess the functional activity of recombinant D. discoideum abcD1?

Assessing the functional activity of recombinant D. discoideum abcD1 requires multiple complementary approaches:

  • ATP Binding and Hydrolysis Assays:

    • Colorimetric ATPase assays to measure inorganic phosphate release

    • ATP binding assays using fluorescent ATP analogs

    • Controls should include known inhibitors of ABC transporters

  • Substrate Transport Assays:

    • Reconstitute purified abcD1 into liposomes or nanodiscs

    • Measure transport of radiolabeled or fluorescently labeled potential substrates

    • Compare transport kinetics with and without ATP

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine protein stability

  • In Vivo Complementation Studies:

    • Express D. discoideum abcD1 in knockout models (either D. discoideum abcD1 mutants or yeast models lacking homologous transporters)

    • Assess restoration of phenotypes related to fatty acid metabolism

    • Measure relevant metabolites using mass spectrometry

  • Protein-Protein Interaction Analysis:

    • Identify potential interaction partners through co-immunoprecipitation

    • Verify interactions using techniques such as bioluminescence resonance energy transfer (BRET)

    • Assess the impact of these interactions on abcD1 function

Each approach provides complementary information about different aspects of abcD1 function, from basic biochemical activities to physiological relevance.

What are the key considerations when designing experiments to study D. discoideum abcD1 function during development and multicellular stages?

When investigating abcD1 function during D. discoideum development and multicellularity, researchers should consider these experimental design elements:

  • Developmental Timeline Monitoring:

    • Track abcD1 expression throughout the developmental cycle using RT-PCR or RNA sequencing

    • Correlate expression with specific developmental stages (aggregation, mound formation, slug migration, culmination)

    • Design sampling intervals appropriate for capturing rapid developmental transitions

  • Spatial Expression Analysis:

    • Use in situ hybridization or reporter constructs to visualize abcD1 expression in different cell types during development

    • Assess whether expression is uniform or restricted to specific regions or cell types

    • Consider cell sorting techniques to isolate specific cell populations for molecular analysis

  • Functional Perturbation Strategies:

    • Generate abcD1 knockout strains using CRISPR-Cas9 or homologous recombination

    • Create conditional expression systems for temporal control of abcD1 function

    • Design specific mutations affecting transport function while preserving protein expression

  • Phenotypic Assays:

    • Measure slug migration distance to assess social motility

    • Evaluate fruiting body formation and spore viability

    • Assess cell counting to measure population growth under different conditions

    • Compare developmental timing between wild-type and abcD1-modified strains

  • Environmental Variable Control:

    • Standardize culture conditions prior to initiating development

    • Consider the impact of bacterial food source on developmental outcomes

    • Control for cell density, substrate material, temperature, and humidity

  • Comparative Analysis Framework:

    • Compare developmental phenotypes between abcD1 mutants and other ABC transporter mutants

    • Assess genetic interactions by creating double mutants with genes in related pathways

    • Evaluate conservation of developmental functions with homologous transporters in other species

These methodological considerations enable rigorous investigation of abcD1's role in the unique developmental processes of D. discoideum, particularly its transition from unicellular to multicellular forms .

What emerging technologies could advance our understanding of D. discoideum abcD1 structure and function?

Several cutting-edge technologies hold promise for expanding our knowledge of D. discoideum abcD1:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Application: Determine high-resolution structures of abcD1 in different conformational states

    • Advantage: Allows visualization of membrane proteins without crystallization

    • Experimental Design: Purify abcD1 in nanodiscs or detergent micelles for structural determination

  • Single-Molecule Techniques:

    • Application: Analyze the dynamics of individual abcD1 transporters during the transport cycle

    • Methods: Single-molecule FRET, optical tweezers, or atomic force microscopy

    • Expected Insights: Conformational changes during substrate binding and transport

  • Advanced Genome Editing:

    • Application: Create precise modifications in abcD1 coding and regulatory regions

    • Technologies: CRISPR-Cas9 base editing or prime editing for subtle mutations

    • Advantage: Generate allelic series to dissect structure-function relationships

  • Proteomics and Interactomics:

    • Application: Identify the protein interaction network of abcD1

    • Methods: BioID, proximity labeling, or cross-linking mass spectrometry

    • Expected Outcomes: Discovery of regulatory partners and substrate handling machinery

  • Single-Cell Transcriptomics:

    • Application: Analyze abcD1 expression heterogeneity during development

    • Advantage: Reveals cell-type specific regulation impossible to detect in bulk analysis

    • Experimental Design: Profile different cell populations during multicellular development

These technologies could resolve outstanding questions about how abcD1 functions at the molecular level and how its activity integrates with D. discoideum's complex life cycle and metabolism.

How might comparative studies between D. discoideum abcD1 and ABC transporters in other organisms advance our understanding of transporter evolution?

Comparative studies offer powerful insights into the evolutionary trajectory of ABC transporters:

  • Phylogenetic Analysis Framework:

    • Construct comprehensive phylogenies including ABC transporters from diverse organisms

    • Map functional diversification against speciation events

    • Identify conserved motifs versus lineage-specific adaptations

  • Functional Conservation Testing:

    • Express abcD1 orthologs from different species in a common cellular background

    • Compare substrate specificity and transport kinetics

    • Assess cross-species complementation of knockout phenotypes

  • Structural Evolution Mapping:

    • Compare protein structures across evolutionary distance

    • Identify structural elements contributing to functional specialization

    • Trace the evolutionary history of domain acquisitions and rearrangements

  • Developmental Context Analysis:

    • Compare expression patterns and developmental roles of abcD1 homologs

    • Assess how multicellularity has shaped transporter function

    • Investigate whether social amoebae transporters retain ancestral features lost in animal or fungal lineages

This comparative approach would build upon existing evolutionary analyses of ABC transporters and could leverage D. discoideum's position in the tree of life, having diverged from the animal/fungal lineage after the plant/animal split while retaining more ancestral genomic diversity than either animals or fungi .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.