Recombinant Dictyostelium discoideum ABC transporter D family member 2 (abcD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
abcD2; DDB_G0293194; ABC transporter D family member 2; ABC transporter ABCD.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcD2
Target Protein Sequence
MEANFVSSALAGVQNNRSVKRSLDRLKSLFSSGQHQLNGSLGKKVFILLALGGGAFSLVK FYKAKNEGSSKQSGLIIDLKDKNSKKDKKRNVTRVDAVFFRRLAKIIRIVIPSLKSKEFL SLLYLTALLFARTMLSVSIAEIAGKNAQNLVARKWKEMRNGVLKFALVSIPASFVNASLK YETDMLALRFRKRLSEYVHKEYLEGVNFYKASHLGGADRIDNADQRVTSDIEQFCNSMSS LYTTLFKPFLDLVLFTRKLVVVMGWGSPLLMFSYFIVSGFLKKLIMPPFGRLTAKQSELE GNYRTVHQRLITNAEEIAFYDGSRKERQIINLSFGDIYNHTGYVSYLKCLVGIFDGFLVK YCASIVGYGCMVLPIYTGIRGSSGKDSTELTKDYIRNTQLMVALSQAIGQLVLLGNKVTL MAGYTSRVSELLEMIKSIKERGTSQFTIVHEDDVPNPLTNSPVNDKYDTSVDMSSWLEDW RKRSDQTRIVKRQQSNRSSASGATTVYGGGTFVEGDFIKFENVSIVSPEGKLLVENLDFQ VMPNQNVMITGPNGSGKSSLFRILGELWPLHCGTVIKPRKEDILFVPQKPYLVLGTLRDQ IIYPHSHDDMKKLGVTDDDLQHLLATVDPNLTIIRQWNWDDTKDWFTALSGGQKQRIAMA RLFYHRPQYAILDECTSAVSDEVEGKIYETCKKLGITLFTVSHRPQLRAYHDYVLLFNGR GGWEWSKIDHDDDHLKKPLSH
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of ABC transporter D family member 2 (abcD2) in Dictyostelium discoideum?

The ABC transporter D family member 2 (abcD2) in D. discoideum belongs to the superfamily of ATP-binding cassette (ABC) transporters characterized by a conserved 200-250 amino acid ATP-binding cassette domain. Based on evolutionary analyses, ABC transporters in D. discoideum serve primarily as exporters, similar to other eukaryotic ABC transporters . The D family of ABC transporters typically contains half-transporters that are localized to peroxisomes and are involved in fatty acid metabolism, though specific functions of abcD2 may vary based on its exact domain topology and sequence homology within the broader ABC superfamily .

What expression systems are most effective for producing recombinant D. discoideum abcD2?

For recombinant expression of D. discoideum proteins including abcD2, several systems have proven effective:

  • Dictyostelium Expression System: The homologous expression in D. discoideum itself often yields properly folded protein with native post-translational modifications. This can be achieved using vectors containing D. discoideum promoters (such as actin 15) and selection markers compatible with the organism's biology.

  • Baculovirus-Insect Cell System: For higher yields while maintaining eukaryotic processing capabilities, baculovirus-mediated expression in insect cells (Sf9, Sf21, or High Five™) often provides properly folded ABC transporters with functional ATP-binding domains.

Methodology for optimal expression should include codon optimization for the chosen expression system, inclusion of purification tags that don't interfere with ATP-binding cassette functionality, and careful consideration of detergents for membrane protein solubilization during purification.

How does the domain architecture of D. discoideum abcD2 compare to homologous proteins in other species?

The domain architecture of D. discoideum abcD2, like other ABC transporters, consists of specific conserved elements. Typically, D family ABC transporters are half-transporters containing one transmembrane domain (TMD) and one nucleotide-binding domain (NBD) .

Based on analyses of ABC transporters in D. discoideum, we can infer the following structural comparison:

SpeciesStructureABC Domain ConservationLSGG MotifTransmembrane Organization
D. discoideum abcD2Half-transporterPresent with Walker A and B motifsConserved between Walker A and B motifsSingle TMD domain
Human ABCD homologsHalf-transporter>55% identity with D. discoideumConservedSimilar organization
Arabidopsis homologsHalf-transporterVariable conservationTypically conservedSimilar organization
S. pombe homologsHalf-transporter>55% identity with D. discoideumConservedSimilar organization

The ABC domains from half-transporters found in members of the A, B, and G families cluster together within their respective families, suggesting functional conservation . While not explicitly stated in the search results, the D family likely follows a similar pattern of evolutionary conservation.

What methodologies are most effective for functional characterization of recombinant abcD2?

For comprehensive functional characterization of recombinant abcD2, researchers should consider a multi-faceted approach:

  • ATP Hydrolysis Assays: Measure the ATPase activity of purified recombinant abcD2 using colorimetric methods to detect inorganic phosphate release, or coupled enzyme assays that link ATP hydrolysis to NADH oxidation.

  • Transport Assays: For half-transporters like abcD2, reconstitution into proteoliposomes followed by transport assays using radiolabeled or fluorescently-labeled substrates can determine substrate specificity and transport kinetics.

  • Genetic Complementation: Generate knockout D. discoideum strains lacking abcD2 and assess whether the recombinant protein can restore normal phenotype, particularly in relation to peroxisomal function and fatty acid metabolism.

  • Localization Studies: Use fluorescent protein tagging or immunolocalization to confirm the subcellular localization of abcD2, which is expected to be peroxisomal for D family transporters.

  • Interaction Studies: Employ pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems to identify protein partners that may regulate abcD2 function or form functional dimers with this half-transporter.

What are the key considerations for designing knockout or knockdown experiments targeting abcD2 in D. discoideum?

When designing genetic manipulation experiments for abcD2 in D. discoideum, researchers should consider:

  • Knockout Strategy Selection:

    • Homologous recombination is highly efficient in D. discoideum

    • CRISPR-Cas9 systems have been adapted for D. discoideum

    • Selection markers should be appropriate for the D. discoideum strain being used

  • Phenotypic Analysis Parameters:

    • Growth rates in axenic media and on bacterial lawns

    • Development and multicellular morphogenesis

    • Peroxisomal function and fatty acid metabolism

    • Resistance to specific compounds that might be transported by abcD2

  • Control Considerations:

    • Include wild-type controls

    • Consider complementation with recombinant abcD2 to confirm phenotype specificity

    • Where possible, create conditional knockouts if complete knockout is lethal

  • Molecular Verification:

    • PCR verification of gene disruption

    • Western blot confirmation of protein absence

    • RNA-seq to assess compensatory changes in other ABC transporters

How can researchers effectively analyze the substrate specificity of recombinant abcD2?

To determine substrate specificity of recombinant abcD2:

  • Competitive Binding Assays: Use a known substrate or ATP analog with fluorescent or radioactive labeling and test competition with candidate substrates.

  • Direct Transport Assays: Reconstitute purified abcD2 into proteoliposomes and measure transport of labeled substrates across the membrane.

  • ATPase Stimulation Assays: Many ABC transporters show enhanced ATPase activity in the presence of their transport substrates. Researchers can screen potential substrates by measuring changes in ATP hydrolysis rates.

  • Resistance Profiling: Express abcD2 in heterologous systems or D. discoideum strains lacking the endogenous transporter and test for resistance to various compounds that might be exported by abcD2.

  • Structural Modeling and Docking: Use homology modeling based on crystal structures of related ABC transporters to predict binding sites, followed by in silico docking of potential substrates.

How can abcD2 mutants provide insight into evolutionary conservation of ABC transporter function?

Analysis of abcD2 mutants can reveal important insights about evolutionary conservation of ABC transporters:

  • Comparative Mutational Analysis: By introducing equivalent mutations in abcD2 and its orthologs in humans, fungi, and plants, researchers can determine if functional consequences are conserved across evolutionary distance.

  • Domain Swapping Experiments: Creating chimeric proteins with domains from abcD2 and other ABC transporters can reveal which structural elements determine substrate specificity and functional properties.

  • Evolutionary Rate Analysis: Comparison of substitution rates in different domains of abcD2 across species can identify regions under purifying selection (highly conserved and functionally critical) versus those under diversifying selection.

The evolutionary analysis of ABC transporters in D. discoideum suggests that many of the genes inferred to have been present in the ancestor of crown organisms duplicated extensively in some but not all phyla, while others were lost in one lineage or another . This makes D. discoideum abcD2 valuable for understanding the evolutionary trajectory of ABC transporters across eukaryotes.

What role might abcD2 play in D. discoideum's response to environmental stressors?

While the search results don't directly address abcD2's role in stress response, we can infer potential functions based on ABC transporter biology:

  • Metabolic Adaptation: As a peroxisomal transporter likely involved in fatty acid metabolism, abcD2 may be crucial during nutrient limitation when D. discoideum transitions from unicellular growth to multicellular development.

  • Xenobiotic Resistance: ABC transporters often contribute to cellular detoxification by exporting harmful compounds. In D. discoideum, which feeds by phagocytosis in soil environments, abcD2 might protect against toxic substances encountered in its natural habitat.

  • Lipid Homeostasis: During stress conditions, proper lipid metabolism is essential for membrane integrity and signaling. abcD2 could regulate peroxisomal import or export of fatty acids or derivatives crucial for these processes.

  • Developmental Regulation: The transition from unicellular to multicellular stages in D. discoideum represents a stress response. ABC transporters may regulate signaling molecule export during this process.

For experimental investigation, researchers should analyze abcD2 expression levels and knockout phenotypes under various stress conditions, including nutrient deprivation, oxidative stress, and exposure to toxins.

What are the major challenges in obtaining pure, functional recombinant D. discoideum abcD2?

Producing recombinant ABC transporters presents several challenges:

  • Membrane Protein Solubilization: ABC transporters are membrane proteins that require careful solubilization.

    • Solution: Optimize detergent selection (DDM, LMNG, or digitonin often work well) and concentration for extraction without denaturation.

  • Protein Stability: ABC transporters often show low stability once extracted from membranes.

    • Solution: Include stabilizing ligands during purification, consider nanodiscs or amphipols for membrane mimetics, and optimize buffer conditions.

  • Expression Levels: Membrane proteins often express poorly in heterologous systems.

    • Solution: Test multiple expression systems, optimize codon usage, and consider fusion partners that enhance folding and membrane insertion.

  • Functional Verification: Confirming that purified protein retains normal function can be challenging.

    • Solution: Develop robust activity assays for both ATP hydrolysis and transport function, preferably with high-throughput capability for screening purification conditions.

  • Post-Translational Modifications: If abcD2 requires specific modifications for function, these may be missing in heterologous systems.

    • Solution: Consider using D. discoideum itself or closely related eukaryotic expression systems.

How can researchers address contradictory data when examining abcD2 function across different experimental systems?

When facing contradictory results in abcD2 research:

  • Standardize Experimental Conditions: Ensure that buffer components, temperature, pH, and other variables are consistent across experiments.

  • Consider Protein Conformation: ABC transporters cycle through different conformational states during the transport cycle. Contradictory results might reflect capture of different states.

  • Validate Antibody Specificity: For immunodetection methods, verify antibody specificity against knockout controls and recombinant standards.

  • Assess Oligomeric State: Determine if abcD2 functions as a homodimer, heterodimer, or higher-order complex in different experimental systems, as this could explain functional differences.

  • Examine Cellular Context: When comparing results between heterologous expression and native systems, consider that interacting partners or lipid environment may differ.

  • Integrate Multiple Methodologies: Combine biochemical, genetic, and imaging approaches to develop a more comprehensive understanding of abcD2 function.

How might systems biology approaches enhance our understanding of abcD2 function within the context of the complete D. discoideum ABC transporter network?

Systems biology offers powerful approaches to contextualize abcD2 within the broader ABC transporter network:

  • Transcriptomic Profiling: RNA-seq analysis comparing wild-type and abcD2-knockout D. discoideum during different life cycle stages and stress conditions could reveal compensatory changes in other ABC transporters.

  • Proteome-Wide Interaction Mapping: Techniques such as BioID or proximity labeling could identify proteins that physically interact with abcD2, revealing functional networks.

  • Metabolomic Analysis: Comparing metabolite profiles between wild-type and abcD2-deficient cells could identify accumulating substrates or depleted products, indicating transport specificity.

  • Network Modeling: Integrating transcriptomic, proteomic, and metabolomic data to build comprehensive models of ABC transporter function during D. discoideum development and stress response.

  • Comparative Genomic Analysis: Systematic comparison of ABC transporter repertoires across related species could reveal evolutionary patterns of functional specialization or redundancy.

These approaches could leverage the evolutionary analysis of ABC transporters in D. discoideum, which has identified 68 members of this superfamily , to understand how abcD2 fits into this broader network.

What emerging technologies might revolutionize research on D. discoideum ABC transporters?

Several cutting-edge technologies hold promise for advancing abcD2 research:

  • Cryo-Electron Microscopy: High-resolution structural determination of membrane proteins has been revolutionized by cryo-EM, potentially allowing visualization of abcD2 in different conformational states during the transport cycle.

  • Single-Molecule Techniques: Methods such as single-molecule FRET could track conformational changes in real-time, providing insights into the dynamics of transport.

  • Nanobody Development: Developing nanobodies against specific conformations of abcD2 could stabilize the protein for structural studies and provide tools for tracking specific states in vivo.

  • Optogenetic Control: Engineering light-sensitive domains into abcD2 could allow precise temporal control of transport activity in living cells.

  • Artificial Intelligence for Substrate Prediction: Machine learning approaches trained on known ABC transporter substrates could predict potential substrates for abcD2, narrowing the field for experimental validation.

  • Genome-Wide CRISPR Screens: Systematic genetic interaction mapping could identify synthetic lethal or synthetic viable interactions with abcD2, revealing functional relationships and compensatory pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.