Recombinant Dictyostelium discoideum ABC transporter D family member 3 (abcD3)

Shipped with Ice Packs
In Stock

Description

Overview of abcD3 in Dictyostelium discoideum

The ABC transporter D family (ABCD) in D. discoideum comprises half-transporters that require dimerization for functionality. The genome of D. discoideum contains 3 ABCD half-transporters, as classified by phylogenetic analysis . While abcD3 has not been explicitly characterized in isolation, studies on ABC transporters in this organism reveal their involvement in:

  • Peroxisomal membrane function (inferred from human ABCD3 homologs)

  • Developmental processes, including spore and stalk differentiation

  • Stress response and substrate export

Gene and Protein Architecture

  • Gene locus: Part of the ABCD subfamily, which is evolutionarily conserved but distinct from mammalian ABCD transporters .

  • Domain structure: Contains a nucleotide-binding domain (NBD) with conserved Walker A/B motifs and a transmembrane domain (TMD) .

Evolutionary Context

Comparative genomic analysis reveals:

FamilyD. discoideumHumans
ABCD3 half-transporters4 half-transporters
(Adapted from Table 1 in )

This suggests functional divergence between species, with D. discoideum ABCD transporters likely tailored to protist-specific processes.

Recombinant Production Methods

Recombinant abcD3 can be synthesized using heterologous expression systems. Key methodologies include:

  • Expression in mammalian cells: HEK293 cells have been successfully used for recombinant Dictyostelium proteins, achieving proper folding and membrane localization (e.g., TMEM16 homologs) .

  • Tags for purification: His-tag or GFP-fusion constructs enable affinity chromatography and cellular tracking .

Example Protocol

  1. Cloning: Amplify the abcD3 gene from D. discoideum cDNA.

  2. Vector construction: Insert into mammalian expression vectors (e.g., pEGFP-N1 for GFP tagging) .

  3. Transfection: Use HEK293 cells and confirm expression via Western blot .

Developmental Regulation

  • Phenotypic impact: ABC transporter mutants in D. discoideum exhibit altered sporulation and slug migration, suggesting roles in intercellular signaling .

  • Transcriptional profiling: ABC transporters influence the expression of 668 developmental genes, including those regulating spore maturation .

Physiological Significance

  • Peroxisomal function: ABCD transporters in D. discoideum may facilitate fatty acid import into peroxisomes, akin to human ABCD3 .

  • Drug resistance: ABC transporters contribute to toxin export, a trait conserved across eukaryotes .

Table 1: Functional Attributes of D. discoideum ABCD Transporters

AttributeabcD3 (Inferred)abcG6abcG18
LocalizationPeroxisomalPlasma membraneVacuolar
Developmental roleSpore maturationStalk cell formationSignal transduction
Substrate specificityFatty acidsSecondary metabolitesSignaling molecules
(Synthesized from )

Applications and Future Directions

Recombinant abcD3 holds potential for:

  • Disease modeling: Studying peroxisomal disorders (e.g., Zellweger syndrome) due to functional parallels with human ABCD3 .

  • Drug discovery: High-throughput screening for inhibitors/activators of ABC transporter activity .

Critical gaps remain, including resolving abcD3’s exact substrates and its dimerization partners. Advanced structural studies (e.g., cryo-EM) and targeted gene knockout assays are recommended for further characterization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparation.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
abcD3; DDB_G0279919; ABC transporter D family member 3; ABC transporter ABCD.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-750
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcD3
Target Protein Sequence
MKKNNVNNITETLNSSSSSSSSSGSSSDEEVKSKLNFNQTDEMLKKIKENKFDWALFKRF IKIVIILYEKPVIPLLLFLLLFGSGVSQTYISKFTGILLSNIYGSLTSGDKFLFVSSLIK GCFAIGGSALFDAIIKFIVSIMAWNWRKTLCLYIQNVYFKKSLFYKILAFDDRIDNPDQR ITSDIDNFTTLLSSIVSQCITGPMVVVYYTYLCYTTIDWYAPLIVYGYFFLGYFINKLVM SPMVSINYLQDKLEGDFRYLHQRIRNFSESIALYNLSKEKQQKKSTTSVDNLDYYDDDHH YHHHHDDGEESDEYTDKTKIINRKNKNSKNKRSALLKRSNKNIKNEELLVEEEQAKQQFE ALLKNKKRVIFWQFGLNTTSDMFTFFSPLINYFIISIPVFFLSSKAALEPAQVTVQSYNC IMLASGFSQYINVSQSISDLSGYISRISTMIEVCKKVMGDTSLDIEITKLNEKDKTKSLP NSLIINNRDTSINTDFRHISLNEGESITLDDVTYFTPKGTQLYEKISICIKKGNNLLIMG PSGSGKSSLIRIINGLWPFFKGSINRPENEDMFFLPQQPYLIFGTLEEQILYPFSKKQKR IPKSIMRELFQRFDIDYLLDRERFIKKSAQVNDLTHNWLNQLSPGEQQLIAIIRLIYHKP KFALMDESTSSIPQSLEERVYSVAKELGITIISVGHRISLLKYHSTLLRFDKDKNWYLED IINQNNQSNNINTINIDNNTNKIAEDSVFD
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of abcD3 in Dictyostelium discoideum?

The ABC transporter D family member 3 (abcD3) in D. discoideum belongs to the ABC superfamily, characterized by the presence of ATP-binding cassettes. Like other ABC transporters, abcD3 contains two copies of a conserved ABC domain of approximately 200 amino acid residues, which includes ATP-binding sites with identifiable Walker A and B motifs. Between these motifs is the characteristic LSGG sequence that defines ABC transporters . The protein also contains transmembrane domains arranged in a specific topology that classifies it within the D subfamily of ABC transporters. The abcD subfamily typically consists of half-transporters that must dimerize to form functional transport units. In D. discoideum, the abcD family members are primarily associated with peroxisomal functions, similar to their homologs in other organisms .

How does abcD3 fit into the evolutionary history of ABC transporters in Dictyostelium?

The ABC superfamily is one of the largest gene families in both prokaryotes and eukaryotes. Comprehensive evolutionary analyses revealed that D. discoideum possesses 68 ABC transporter genes, which have been classified according to sequence homology, domain topology, and function . These transporters form robust phylogenetic trees when clustered based on either their ABC domains or full sequences.

The common ancestor of plants, animals, fungi, and D. discoideum likely possessed approximately 25 genes encoding ABC proteins, which expanded through duplication events to form the current superfamily in D. discoideum . The D family in Dictyostelium shows evolutionary relationships with peroxisomal transporters from other species, suggesting conserved functions across eukaryotic lineages. This evolutionary conservation makes abcD3 an excellent model for understanding fundamental aspects of eukaryotic ABC transporter biology.

What are the optimal methods for expressing and purifying recombinant abcD3 protein?

For successful expression and purification of recombinant abcD3, researchers typically employ several approaches:

Expression systems:

  • Bacterial expression using E. coli BL21(DE3) strains with codon optimization for the AT-rich D. discoideum genome

  • Yeast expression systems (P. pastoris or S. cerevisiae) for proper folding of eukaryotic membrane proteins

  • Insect cell expression systems (Sf9 or High Five) using baculovirus vectors for higher yields of functional protein

Purification protocol:

  • Solubilization of membrane fractions using mild detergents (DDM, LMNG, or CHAPS)

  • Affinity chromatography using N-terminal His6 or Strep tags

  • Size exclusion chromatography for obtaining homogeneous protein preparations

  • Consider using nanodiscs or amphipols for stabilization during purification

When working with D. discoideum ABC transporters, it's crucial to include ATP or non-hydrolyzable ATP analogs (AMP-PNP) in purification buffers to stabilize the protein. For functional studies, reconstitution into proteoliposomes often yields better results than detergent-solubilized preparations.

What genetic modification techniques are most effective for studying abcD3 function in D. discoideum?

Multiple genetic approaches can be employed to study abcD3 function:

Gene disruption and knockout strategies:

  • Homologous recombination with selection markers (blasticidin or G418 resistance cassettes)

  • CRISPR-Cas9 gene editing with ribonucleoprotein complexes

  • REMI (Restriction Enzyme Mediated Integration) mutagenesis

Protein tagging methods:

  • C-terminal GFP or mCherry fusion for localization studies

  • Split-GFP complementation for protein-protein interaction studies

  • BioID or APEX2 proximity labeling for identifying interaction partners

When generating knockout mutants, it's important to verify disruption at both genomic and transcript levels, as D. discoideum often shows compensatory expression of related ABC transporters . For phenotypic characterization, both morphological and transcriptional analyses are recommended, as many ABC transporter mutants exhibit subtle morphological phenotypes but more pronounced transcriptional changes .

What is the substrate specificity of abcD3 and how can it be experimentally determined?

Determining the substrate specificity of abcD3 requires multiple complementary approaches:

In vitro transport assays:

  • Reconstitution of purified abcD3 into proteoliposomes

  • Measurement of ATP-dependent transport of radiolabeled or fluorescently-labeled candidate substrates

  • Competition assays with non-labeled substrates to determine relative affinities

In vivo functional assays:

  • Growth tests of abcD3 knockout strains on various carbon sources

  • Metabolite profiling of wild-type versus abcD3 mutant cells

  • Subcellular accumulation of fluorescent substrate analogs

How does abcD3 contribute to the developmental program of D. discoideum?

D. discoideum undergoes a complex developmental program in response to starvation, transitioning from unicellular amoebae to a multicellular fruiting body. The role of abcD3 in this process can be investigated through:

Developmental timing and morphology:

  • Time-course analysis of development in abcD3 mutants versus wild-type

  • Quantitative assessment of cell aggregation, mound formation, and fruiting body morphology

  • Cell-type specific markers to identify defects in prestalk/prespore differentiation

Transcriptional analysis:

  • RNA-seq or RT-qPCR of developmental genes in abcD3 mutants

  • Comparison with transcriptional phenotypes of other ABC transporter mutants

  • Identification of genes whose expression is specifically affected by abcD3 disruption

Studies of ABC transporters in D. discoideum development have shown that most mutants exhibit subtle morphological phenotypes, but their transcriptional phenotypes can be more revealing . Analysis of these transcriptional changes in abcD3 mutants could identify potential regulatory roles in development, possibly through transport of lipid signaling molecules or metabolites required for proper development.

How does the ATP hydrolysis cycle couple to substrate transport in abcD3?

Understanding the mechanistic coupling between ATP hydrolysis and substrate transport requires sophisticated biochemical and biophysical approaches:

ATPase activity assays:

  • Colorimetric assays measuring inorganic phosphate release

  • Coupled enzyme assays (with pyruvate kinase and lactate dehydrogenase)

  • Assessing the effects of potential substrates on ATPase activity

Transport mechanism studies:

  • Site-directed mutagenesis of key residues in the Walker A/B motifs and LSGG signature sequence

  • Analysis of conformational changes using EPR spectroscopy or FRET

  • Single-molecule studies to observe transport cycles

The general mechanism for ABC transporters involves ATP binding inducing dimerization of the nucleotide-binding domains, which causes conformational changes in the transmembrane domains to facilitate substrate translocation. Key residues in abcD3 can be identified by sequence alignment with better-characterized ABC transporters and targeted for mutagenesis to disrupt specific steps in the transport cycle.

What is the interactome of abcD3 and how does it regulate transporter function?

Identifying the protein interaction network of abcD3 provides insights into its regulation and cellular functions:

Interaction identification methods:

  • Immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches (BioID, APEX2)

  • Yeast two-hybrid screening with soluble domains

  • Split-ubiquitin membrane yeast two-hybrid for membrane protein interactions

Functional validation:

  • Co-localization studies using fluorescently tagged proteins

  • FRET or BRET to confirm direct interactions

  • Functional assays in the presence or absence of interacting partners

ABC transporters often interact with regulatory proteins that modulate their activity or localization. For peroxisomal ABC transporters like abcD3, interactions with peroxisomal membrane proteins and peroxisomal biogenesis factors are particularly relevant. Additionally, interactions with lipid-binding proteins might facilitate substrate delivery to the transporter.

How does D. discoideum abcD3 compare to homologs in other organisms?

Comparing abcD3 with homologs in other species provides evolutionary insights and functional predictions:

Comparative analysis table of abcD3 homologs:

OrganismHomologIdentity (%)Key Functional DifferencesSubcellular Localization
Homo sapiensABCD1 (ALDP)~40-45Associated with X-linked adrenoleukodystrophyPeroxisomal membrane
Homo sapiensABCD3 (PMP70)~45-50Broader substrate range including bile acid precursorsPeroxisomal membrane
Saccharomyces cerevisiaePxa1/Pxa2~35-40Functions as heterodimerPeroxisomal membrane
Arabidopsis thalianaABCD1~30-35Role in β-oxidation of fatty acids during seed germinationPeroxisomal membrane

What can we learn about human ABCD transporters from studying D. discoideum abcD3?

D. discoideum serves as a powerful model system for understanding human ABCD transporters for several reasons:

  • Evolutionary conservation of core transport mechanisms and substrate preferences

  • Simpler genetic background with fewer compensatory mechanisms

  • Ease of genetic manipulation compared to mammalian systems

  • Ability to study developmental roles not accessible in cell culture

Mutations in human ABCD transporters cause several peroxisomal disorders, including X-linked adrenoleukodystrophy (ABCD1) and Zellweger syndrome. Studying abcD3 in D. discoideum can provide insights into:

  • Basic mechanisms of substrate recognition and transport

  • Protein quality control and trafficking to peroxisomes

  • Metabolic adaptations to changes in lipid availability

  • Potential therapeutic strategies for peroxisomal disorders

The relatively high sequence similarity between D. discoideum abcD3 and human ABCD proteins (~45-50%) facilitates translational research, where findings in the model organism can inform studies of human disease mechanisms .

How can abcD3 be used as a tool for studying peroxisomal function in D. discoideum?

As a peroxisomal transporter, abcD3 provides several experimental opportunities:

Applications as a research tool:

  • Using tagged abcD3 as a marker for peroxisome biogenesis and dynamics

  • Engineering substrate-specific variants for metabolic studies

  • Developing abcD3-based biosensors for fatty acid metabolism

  • Using abcD3 promoter-reporter constructs to monitor peroxisomal proliferation signals

Experimental approaches:

  • Live-cell imaging of GFP-tagged abcD3 to track peroxisome movement and distribution

  • Inducible expression systems to control abcD3 levels and study metabolic adaptation

  • Structure-function studies to identify critical domains for targeting and function

Understanding peroxisomal transport through abcD3 can illuminate broader aspects of D. discoideum biology, including adaptation to different carbon sources, stress responses, and developmental regulation of metabolism.

What are the most promising future research directions for abcD3 studies?

Several emerging areas offer opportunities for significant advances in abcD3 research:

Structural biology:

  • Cryo-EM structures of abcD3 in different conformational states

  • Molecular dynamics simulations to understand substrate translocation pathways

  • Structure-guided design of specific inhibitors or activators

Systems biology:

  • Integration of abcD3 function into genome-scale metabolic models of D. discoideum

  • Network analysis of transcriptional changes in abcD3 mutants across developmental time points

  • Multi-omics approaches to understand compensatory mechanisms in abcD3 knockouts

Translational research:

  • Using D. discoideum as a screening platform for compounds that modulate ABCD transporter function

  • Engineering abcD3 variants that mimic human disease mutations

  • Exploring potential of abcD3 as a target for modulating D. discoideum lipid metabolism

These future directions will benefit from emerging technologies like CRISPR-based screening, advanced imaging techniques, and improved computational modeling approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.