Recombinant Dictyostelium discoideum ABC transporter G family member 20 (abcG20)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant abcG20 is a full-length (1–730 amino acids), His-tagged protein expressed in Escherichia coli ( ). Key specifications include:

PropertyDetail
UniProt IDQ8T674
Molecular Weight~82 kDa (predicted)
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose ( )
Sequence FeaturesContains conserved ABC transporter domains and transmembrane helices

This recombinant protein is primarily utilized for in vitro studies, including substrate transport assays and structural analyses ( ).

Evolutionary and Genomic Context

abcG20 belongs to the ABCG subfamily, which originated from ancestral ABCA-family genes through domain duplication and rearrangement ( ). Key evolutionary insights:

  • Gene Clustering: abcG20 shares phylogenetic proximity with Drosophila CG9990 and human ABCG homologs, suggesting conserved roles in transmembrane transport ( ).

  • Genomic Expansion: D. discoideum encodes 68 ABC transporters, reflecting adaptations for complex environmental interactions ( ).

  • Functional Redundancy: Most ABCG transporters in Dictyostelium exhibit subtle phenotypic effects when disrupted, hinting at overlapping roles in development ( ).

Research Applications

Recombinant abcG20 enables mechanistic studies on:

  • Substrate Specificity: ABCG transporters often export lipids, sterols, or signaling molecules. Structural analysis of abcG20 could identify binding pockets ( ).

  • Evolutionary Biology: Comparative studies with plant ABCG20 homologs (e.g., Medicago truncatula MtABCG20, an ABA exporter) may reveal conserved transport mechanisms ( ).

  • Drug Resistance: Eukaryotic ABC transporters confer multidrug resistance; abcG20 could model these processes ( ).

Technical Considerations

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with glycerol (5–50%) for stability ( ).

  • Activity Assays: ATP-dependence is critical for functional validation, as seen in heterologous systems ( ).

Unanswered Questions

  • Does abcG20 interact with osmosensors like ACG during spore maturation ( )?

  • What substrates are transported by abcG20, and how do they influence Dictyostelium development or symbiosis with bacteria ( )?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order remarks, and we will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
abcG20; DDB_G0267430; ABC transporter G family member 20; ABC transporter ABCG.20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-730
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcG20
Target Protein Sequence
MSNSNNNNNNKKLAISLKNVCRGYGNTKVIDNLNLQIKSGTINCLIGASGSGKTTILRTI LGRLIPDSGEVLVFGKRPHDIGGVPGSICGFCPQEGALYYDLTLDHTLNFFSNVHQIPKD KFESKKNEIIKLLDLPQINSRSVGLLSGGQKKRVSLAVALLHSPKLLILDEPTVGIDMEV ASNIWSYLRSLANSGVTIIITTHYINEAVGSDNVFLLRDGKILENGAPNYLIERYESQTL EEVFLKLCKRDNAQSIVDSKKNNNNSYFSSQEIIDVESHIVNNNNNNNNNNNNNNYNNND DEENYNDDIYNDKKPLIGISKEDENNTNGSTNKESGILFRFYKVLLHSVAIGKRKFIQII RNKVVLSFELLSPSVQVLLYFLAIGGSPKNLEFGVVNLDVGPIGSMYINSLSNTGIFNFH NYNSTTEAIEQIKSGNSFGLLDINAQFSEAILENFMNLSQYNPNGQIDLYMDFTNYQITL IVEQQLALSFETLAKQQANITMNPIKTVTPTVYGNPNSKFIDFLAPGMVCLISFAHAISI TSVSFVKEKVDGSLDRLFAYGVRTSSIVFGHFLGHLPLLLVQITVLLLIAIYGFNVPIEG NIALVFLMTVSLAFVGMSLGLVISAVSRVETEAIQLSLGVYFPTLICSGTLWPLQSLPNW FVWFPNILPATHAGNAMRDIMLKGVGLHYKEVWVAFLVVLSWLIFLIFIAVLALNEKDKN LKLSCFKKRK
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of abcG20 within the D. discoideum ABC transporter family?

Dictyostelium discoideum possesses 68 ABC transporters annotated in its genome, with abcG20 belonging to the G subfamily of these transmembrane proteins . Like other ABC transporters, abcG20 contains characteristic ATP-binding cassette domains that enable the translocation of molecules across cell membranes through ATP hydrolysis. Within the context of D. discoideum's relatively small 34 Mb genome, the ABC transporter genes represent a significant family of functional proteins involved in various cellular processes .

How does abcG20 expression change during the Dictyostelium life cycle?

Expression analysis reveals that abcG20, like other ABC transporters in Dictyostelium, exhibits developmental regulation. During the transition from unicellular growth to multicellular development triggered by starvation, abcG20 shows specific temporal expression patterns. RNA-seq analysis using normalized read counts from DESeq2 can be used to profile these changes across different developmental stages . Researchers should monitor expression changes particularly during the critical transitions from aggregation to slug formation and during culmination, as these represent key developmental checkpoints where ABC transporters often show significant regulation.

What cellular localization patterns are observed for abcG20 protein?

The abcG20 protein, like other members of the ABC transporter G subfamily in Dictyostelium, typically localizes to the plasma membrane or specific internal membrane compartments. Determining precise localization requires fluorescent tagging approaches, often using GFP fusion constructs expressed under the native promoter to maintain physiological expression levels. When designing such constructs, researchers should consider that the AX4 strain background (available from dictyBase, ID: DBS0237637) is frequently used for such studies to ensure consistency with the reference genome .

What are the most effective methods for generating abcG20 knockout mutants?

For generating abcG20 knockout mutants, homologous recombination using a Blasticidin S resistance (Bsr) cassette is the preferred approach in Dictyostelium. The Bsr selection system offers high efficiency and typically results in single-copy integrants, making it ideal for targeted gene disruption .

A robust protocol involves:

  • Constructing a gene targeting vector containing the Bsr-cassette flanked by loxP recombination sites

  • Transforming the construct into AX4 cells

  • Selecting transformants on Blasticidin S (40 μg/ml)

  • Verifying disruption by PCR and Southern blot analysis

The expected targeted disruption frequency is approximately 80% when using properly designed homology arms . For subsequent genetic manipulations, the Bsr marker can be recycled using Cre-mediated recombination through transient expression of the pDEX-NLS-cre plasmid, which removes the Bsr cassette while maintaining the disruption .

How can researchers effectively express recombinant abcG20 protein for functional studies?

Expressing recombinant abcG20 requires optimization of several parameters to ensure proper folding and functionality of this transmembrane protein. A recommended approach includes:

  • Cloning the abcG20 coding sequence into the pDEXRH expression vector under the control of the constitutive actin 15 (act15) promoter

  • Adding an affinity tag (His, FLAG, or TAP) for purification and detection

  • Transforming the construct into either wild-type or abcG20-null cells

  • Selecting transformants with G418 at 10-20 μg/ml

  • Verifying expression by Western blot analysis

For growth and maintenance of transformants, use modified HL5 medium (2.5 g Tryptose, 2.5 g Proteose Peptone A, 2.5 g yeast extract, 5 g glucose per 500 ml) supplemented with appropriate antibiotics at 20°C with shaking at 200 rpm .

What approaches are recommended for phenotypic characterization of abcG20 mutants?

Phenotypic characterization of abcG20 mutants should include both morphological and transcriptional analyses, as ABC transporter mutants often exhibit subtle morphological phenotypes but more pronounced transcriptional changes .

A comprehensive phenotypic analysis should include:

  • Growth rate measurement in axenic medium

  • Development on non-nutrient agar observed at 2-hour intervals

  • Spore and stalk cell differentiation assays

  • Resistance profiling against various compounds to identify potential substrates

  • RNA-seq analysis to identify genes with altered expression patterns

For development assays, harvest cells during logarithmic growth, wash them with KK2 buffer (16.3 mM KH₂PO₄), and plate on non-nutrient phosphate agar at a density of 5 × 10⁷ cells/cm² .

How does abcG20 function compare with other ABC transporter G family members in Dictyostelium?

Comparative analysis of abcG20 with other G family members, particularly abcG6 and abcG18 (which influence spore differentiation during development), can provide insights into functional specialization . Research indicates that ABC transporters in Dictyostelium can be grouped based on their transcriptional phenotypes, suggesting shared physiological functions.

When comparing transporter functions, examine:

  • Substrate specificity profiles

  • Developmental timing of expression

  • Cellular localization patterns

  • Phenotypic consequences of gene disruption

  • Transcriptional profiles of mutants

The transcriptional phenotyping approach identified 668 genes whose expression remains stable across most ABC transporter mutants, indicating their fundamental role in development . Analyzing how abcG20 disruption affects this core developmental gene set can position its function relative to other family members.

What role might abcG20 play in intercellular signaling during Dictyostelium development?

Specific ABC transporters in Dictyostelium, notably abcG6 and abcG18, have been implicated in intercellular signaling during terminal differentiation of spores and stalks . To investigate whether abcG20 serves a similar function:

  • Perform mixing experiments between wild-type and abcG20-null cells at different ratios

  • Analyze cell sorting patterns during multicellular development

  • Monitor expression of cell-type specific markers in chimeric structures

  • Examine the production and response to known developmental signals (cAMP, DIF-1, etc.)

  • Use transcriptional profiling to identify signaling pathways affected by abcG20 disruption

This approach can determine whether abcG20 functions as a transporter of signaling molecules or as a component of signaling response pathways during development.

How does chromatin organization affect abcG20 expression during development?

Recent research indicates that Dictyostelium's 3D genome is organized into positionally conserved, non-hierarchical loops at the onset of multicellular development . This organization influences gene expression patterns during development.

To investigate chromatin-level regulation of abcG20:

  • Analyze the position of abcG20 relative to loop anchors using Hi-C data

  • Determine if abcG20 is part of a loop interior with functionally linked genes

  • Examine if abcG20 is part of a convergent gene pair that could serve as an extrusion barrier

  • Correlate chromatin organization changes with abcG20 expression during development

  • Use RNA-seq data to cluster abcG20 with other genes showing similar expression trajectories

What strategies enable long-term storage and maintenance of abcG20 mutant strains?

For long-term preservation of abcG20 mutant strains:

  • Harvest cells from fresh culture by centrifugation at 400 g (4°C) for 5 minutes

  • Resuspend in ice-cold HL5 medium with 5% DMSO to a concentration of 5 × 10⁶ cells/ml

  • Aliquot into 1.8 ml cryovials

  • Incubate at -80°C for 12 hours in an alcohol-free cell freezing container

  • Transfer to liquid nitrogen for long-term storage

For recovery, thaw frozen stocks and mix with 10 ml of modified HL5 medium in a 100-mm dish, incubate for 30 minutes at 20°C, then remove medium and rinse attached cells with fresh medium .

How can researchers create multiple gene disruptions involving abcG20 and other ABC transporters?

To create multiple gene disruptions involving abcG20 and other transporters, implement the Cre-loxP recycling system:

  • Generate an initial abcG20 knockout using a floxed-Bsr cassette

  • Verify disruption by PCR and Southern blot (expected WT band ~450 bp, disrupted gene ~2000 bp)

  • Transform verified mutants with pDEX-NLS-cre (carrying G418 resistance)

  • Screen transformants for Blasticidin sensitivity by replica plating

  • Confirm Bsr excision by PCR and sequencing

  • Repeat the process with the next target gene

This recycling strategy overcomes the limitation of available selectable markers in Dictyostelium and enables the creation of strains with multiple targeted disruptions to study genetic interactions .

What methods are recommended for RNA-seq analysis to study abcG20 transcriptional networks?

For RNA-seq analysis of abcG20 and related transcriptional networks:

  • Map reads to the D. discoideum genome (version 2.7) using hisat2 with maximum intron length set to 3100 bp

  • Retain only uniquely mapped reads and remove duplicates using samtools

  • Select genes with at least 1 count in 2 samples for downstream analysis

  • Use DESeq2 for normalization and variance estimation

  • Apply rlog transformation to stabilize variance across means

  • Compute correlation matrices and apply k-means clustering to identify trajectory gene clusters (TGCs)

This approach enables identification of genes co-regulated with abcG20 during development and can reveal functional networks associated with this transporter.

How should researchers interpret subtle phenotypes in abcG20 mutants?

When analyzing abcG20 mutants, researchers should be aware that ABC transporter mutants in Dictyostelium typically exhibit subtle morphological phenotypes but more informative transcriptional changes . To properly interpret subtle phenotypes:

  • Conduct quantitative analyses of developmental timing, measuring the hours required to reach each morphological stage

  • Perform microscopic examination of cellular structures and multicellular morphology

  • Quantify spore and stalk cell proportions in culminants

  • Measure spore viability after various stress treatments

  • Analyze transcriptional profiles to identify affected pathways even when morphological changes are minimal

The subtle nature of phenotypes may indicate functional redundancy among ABC transporters, necessitating creation of multiple knockouts to observe more pronounced effects.

What statistical approaches are recommended for analyzing transcriptional phenotypes of abcG20 mutants?

For robust statistical analysis of transcriptional data from abcG20 mutants:

This multi-faceted approach provides greater resolution of phenotypes than morphological analysis alone and can place abcG20 within functional networks based on transcriptional signatures .

How can researchers distinguish between direct and indirect effects of abcG20 disruption?

Distinguishing direct from indirect effects of abcG20 disruption requires:

  • Complementation analysis with wild-type abcG20 to verify phenotype rescue

  • Creation of abcG20 point mutants affecting specific domains (e.g., ATP-binding vs. transmembrane)

  • Identification of putative substrates through transport assays

  • Early time-point analysis after inducing development to identify primary transcriptional responses

  • Comparison with phenotypes of other ABC transporter mutants to identify transporter-specific vs. general effects

Direct effects of abcG20 disruption should manifest early and be rescued by complementation with functional protein, while indirect effects may appear later in development and represent downstream consequences of the primary defect.

What are the common challenges in expressing functional recombinant abcG20?

Common challenges in expressing functional abcG20 include:

  • Protein misfolding due to improper membrane insertion

  • Toxicity when overexpressed

  • Post-translational modification differences

  • Aggregation during solubilization attempts

  • Low expression levels

To overcome these challenges:

  • Use inducible expression systems rather than constitutive promoters

  • Include appropriate signal sequences for membrane targeting

  • Optimize codon usage for Dictyostelium

  • Consider fusion tags that enhance folding and membrane insertion

  • Monitor cellular stress responses during expression

How can researchers overcome technical difficulties in phenotypic characterization of abcG20 mutants?

To overcome difficulties in phenotypic characterization:

  • Increase statistical power by analyzing multiple clones of the same genotype

  • Use quantitative metrics rather than qualitative observations

  • Apply stringent environmental conditions (temperature, pH, osmotic stress) to exaggerate subtle phenotypes

  • Perform competitive growth assays mixing wild-type and mutant cells

  • Analyze development on bacterial lawns in addition to standard non-nutrient agar

These approaches can enhance detection of subtle phenotypic differences between wild-type and abcG20 mutant strains, which is particularly important given that most ABC transporter mutants in Dictyostelium show only minor morphological defects .

What quality control measures are essential for Hi-C and RNA-seq experiments involving abcG20?

Essential quality control measures include:

For Hi-C:

  • Evaluate the reproducibility of replicates using HiCRep correlation coefficients

  • Normalize read depth (approximately 22 million reads per sample)

  • Filter reads to retain only those from main scaffolds

  • Assess mapping quality (MAPQ ≥ 30)

  • Remove PCR duplicates and filter multimappers

For RNA-seq:

  • Verify RNA integrity before library preparation

  • Map reads using appropriate parameters (maximum intron length of 3100 bp for Dictyostelium)

  • Filter for uniquely mapped reads

  • Remove duplicates

  • Select genes with minimum expression thresholds (at least 1 count in 2 samples)

These quality control measures ensure reliable data for interpreting abcG20 function in the context of genome organization and gene expression networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.