Recombinant Dictyostelium discoideum ABC transporter G family member 22 (abcG22)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression

abcG22 is heterologously expressed in microbial systems (E. coli or yeast) for large-scale production. Key parameters include:

ParameterDetail
Tag TypeN-terminal His tag (for E. coli)
Storage BufferTris/PBS-based with 6% trehalose (pH 8.0)
ReconstitutionSterile water (0.1–1.0 mg/mL) + 5–50% glycerol (for stability)

Product Variations

Commercially available forms differ in sequence coverage:

  • Full-length: Includes entire ABC and transmembrane domains .

  • Partial: Excludes certain regions (exact truncation points unspecified) .

ABC Transporter Roles in D. discoideum

While abcG22’s specific function remains under investigation, ABC transporters in D. discoideum are critical for:

  1. Developmental signaling: Regulating intercellular communication during spore-stalk differentiation .

  2. Substrate transport: Translocating small molecules, ions, or signaling factors (e.g., cAMP) .

ABC TransporterDevelopmental RoleSource
abcG6/abcG18Spore differentiation during terminal stages
ACGOsmolyte-activated adenylate cyclase activity

Experimental Uses

  • Structural studies: His-tagged versions enable crystallization and biochemical assays .

  • Functional screening: Mutant strains (e.g., abcG22-) are used to study developmental phenotypes .

Developmental Mutant Analysis

In RNA-seq studies, abcG22 mutants have been profiled alongside other ABC transporters to identify transcriptional networks regulating development. For example:

  • Transcriptional phenotyping: abcG22 mutants may cluster with other ABC transporters affecting spore-stalk patterning .

  • Gene enrichment: ABC transporter mutants often perturb developmental genes (e.g., pkaC, culB) .

Knowledge Gaps

  • Substrate specificity: No direct evidence links abcG22 to specific molecules.

  • Interactome mapping: Partners in signaling pathways remain unidentified.

Research Priorities

  1. Functional assays: Determine transport substrates using in vitro assays.

  2. Developmental genetics: Investigate abcG22’s role in spore-stalk differentiation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
abcG22; DDB_G0270826; ABC transporter G family member 22; ABC transporter ABCG.22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-615
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcG22
Target Protein Sequence
MDQVSIEMSSTPRPTMVKSKSQLSLRRSLTITFKDLAYSVTVKKKKMQILKGVSGTVTPG ELVAVFGPSGSGKTTLLDILANRKESGEISGAVLINGNEIDDDYKRLCSYVVQEDVLLPT ITVRETLRFYADLKLPKSWTEKEKHERIEQILEQIGLSHRADAKIGGVLPGGIVLRGLSG GEKRRVSIGCGLVTSPSIVLLDEPTSGLDTTSAMAVMKTLVELTQQKSVTVICTIHQPRS EIFKLFTKIMVLAEGRLVYYGNRPVEHFTEIGFPFPDQTNPADYILDAVTTIKEEGRADE IADRLQSSYLDQANQESSSTLTQSQLGIINASGKRKINAYNNGLFTQFLVLWKRTGLDFI RNPSNCLVRFAVAVFVGLLFGACFSGLGMDEKGVQSRSAVLFYLVINMILQPFASISLFI SKRTLFNAERASKLYHTLPYYLALMFFEILACIGTAFILGTITYWFADLNPGADKYFFAM AILTLAHLAGDFFMLIISCITVQVDTSFAVGAGVATIYQLFAGFFVPINALPKSFEWLHW CNFVYYSFEALMHNEFVGETVNCGQLACPTGRDVLINLGLNNRGKGINLIIVSSFAFAFF TMVFLCLHYFHREKR
Uniprot No.

Target Background

Function
May be involved in cell migration.
Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is abcG22 and what is its biological significance in Dictyostelium discoideum?

DdABCG22 is one of the 71 different ABC transporter genes in the D. discoideum genome, belonging to the G family of ABC transporters that includes 24 members . The biological significance of abcG22 has been partly revealed through null mutant studies showing that it plays important roles in developmental timing and spore viability. Specifically, null mutations in abcG22 result in delayed development and reduced spore viability, suggesting its critical role in D. discoideum life cycle regulation .

Additionally, abcG22 appears to influence vegetative cell dispersion, as demonstrated in a screening for mutants that revert the dispersive phenotype of the ami8-mutant . The transporter likely functions in signaling pathways that regulate both vegetative growth and multicellular development in this social amoeba. Recent studies suggest it may be involved in cytokinin (CK) transport, though direct evidence confirming this function is still pending .

How does abcG22 compare to similar transporters in other organisms?

Sequence comparison analyses have revealed that D. discoideum ABCG22 shares strong homology with members of the plant ABCG family, particularly Arabidopsis thaliana ABCG14 . In Arabidopsis, the related transporter AtABCG22 is involved in water transpiration and drought susceptibility, with expression predominantly in guard cells . Mutant plants (atabcg22) exhibit lower leaf temperatures and increased water loss due to elevated transpiration through altered stomatal regulation .

What are the recommended methods for generating and validating abcG22 null mutants?

For generating abcG22 null mutants in D. discoideum, homologous recombination remains the gold standard approach. The procedure typically involves:

  • Vector Construction: Design a knockout cassette containing a selection marker (commonly blasticidin resistance) flanked by ~1 kb homologous sequences from both the 5' and 3' regions of the abcG22 gene.

  • Transformation: Introduce the linearized construct into D. discoideum cells using electroporation, with optimal conditions being 1.0 kV, 3 μF, 200 Ω.

  • Selection: Culture transformed cells in medium containing blasticidin (10 μg/ml) to select for successful integrants.

  • Validation: Confirm gene disruption through:

    • PCR verification with primers spanning the integration site

    • Southern blot analysis

    • RT-PCR to confirm absence of abcG22 transcript

    • Western blotting if antibodies against the native protein are available

Previous successful generation of abcG22 null mutants has been reported as part of systematic studies of ABC transporters in D. discoideum . These null strains exhibited subtle but significant phenotypes that were more readily detected through transcriptional profiling than through morphological examination alone .

How can researchers effectively measure abcG22 transport activity?

Measuring transport activity of abcG22 requires specialized approaches due to the challenges in identifying its natural substrates. Recommended methodologies include:

  • Heterologous Expression Systems:

    • Express recombinant abcG22 in Xenopus oocytes or insect cells

    • Purify and reconstitute the protein in proteoliposomes for in vitro transport assays

  • Transport Assays:

    • Radiolabeled substrate uptake/efflux assays

    • Fluorescent substrate accumulation studies

    • ATPase activity assays to measure transport-coupled ATP hydrolysis

  • Substrate Identification Approach:

    MethodAdvantagesLimitations
    Comparative metabolomicsUnbiased detection of multiple compoundsComplex data analysis
    Transport competition assaysDirect evidence for substrate interactionRequires candidate substrates
    Photoaffinity labelingIdentifies binding sitesTechnical complexity
    In silico modelingPredicts potential substratesRequires validation

Given the evidence suggesting abcG22 may be involved in cytokinin transport, testing radiolabeled or fluorescently tagged cytokinins as potential substrates would be a logical starting point . Comparing metabolite profiles between wild-type and abcG22 null cells could also help identify physiological substrates.

How does abcG22 function during different stages of Dictyostelium development?

abcG22 exhibits stage-specific functions throughout the 24-hour developmental cycle of D. discoideum:

  • Vegetative Growth Stage (0-4 hours): abcG22 influences cell dispersion during vegetative growth, as evidenced by its identification in a screen for mutants affecting the dispersive phenotype of ami8-mutants . Recent studies suggest it may be involved in cytokinin-mediated regulation of vegetative cell behavior .

  • Aggregation Stage (4-8 hours): Transcriptional profiling reveals that abcG22 mutations begin to display divergence from wild-type patterns during early aggregation (around 6 hours of development) . This suggests a role in the transition from unicellular to multicellular stages.

  • Post-Aggregative Development (8-18 hours): The most pronounced transcriptional differences between abcG22 mutants and wild-type cells occur at 12-18 hours of development , indicating critical functions during multicellular morphogenesis.

  • Culmination and Sporulation (18-24 hours): The reduced spore viability observed in abcG22 null mutants indicates important functions during terminal differentiation . This may involve transport of signals or metabolites essential for proper spore formation and maturation.

The phenotypic and transcriptional data suggest that abcG22 functions throughout development but is particularly important during the multicellular stages and terminal differentiation in D. discoideum.

What experimental approaches are most effective for studying abcG22's role in intercellular signaling?

To investigate abcG22's role in intercellular signaling, researchers should consider the following approaches:

  • Chimeric Development Assays:

    • Mix GFP-labeled wild-type cells with unlabeled abcG22 mutant cells

    • Monitor cell sorting patterns in chimeric structures

    • Analyze whether abcG22 mutants exhibit non-cell-autonomous effects

  • Conditioned Medium Experiments:

    • Collect medium from developing wild-type and abcG22 mutant cells

    • Test the ability of these conditioned media to rescue developmental defects

    • Fractionate and analyze the media to identify differentially secreted factors

  • Transcriptional Reporter Systems:

    • Generate reporter constructs for developmentally regulated genes

    • Compare expression patterns in wild-type versus abcG22 mutant backgrounds

    • Identify signaling pathways affected by abcG22 mutation

  • Cell-Cell Adhesion and Communication Assays:

    Assay TypeMeasurementRelevance to abcG22
    EDTA-sensitive adhesionEarly cell-cell contactsTests involvement in early development
    Cell cohesiveness assayStrength of cell-cell adhesionEvaluates post-aggregative function
    Optical density wave propagationcAMP signal relayAssesses impact on intercellular signaling

These approaches are particularly relevant since there is evidence that ABC transporters in D. discoideum, including abcG6 and abcG18, have potential roles in intercellular signaling during terminal differentiation of spores and stalks . Similar methodologies could reveal whether abcG22 has analogous functions.

How can researchers effectively analyze the transcriptional profiles of abcG22 mutants?

Based on previous comprehensive studies of ABC transporter mutants in D. discoideum, the following analytical approach is recommended:

  • Experimental Design for RNA Profiling:

    • Collect RNA samples at multiple developmental timepoints (0h, 6h, 12h, 18h)

    • Include biological replicates (minimum 3 per condition)

    • Use appropriate wild-type controls grown under identical conditions

  • Data Analysis Workflow:

    • Perform quality control filtering of raw microarray or RNA-seq data

    • Apply appropriate normalization methods (RMA for microarray, TPM/RPKM for RNA-seq)

    • Conduct differential expression analysis using limma or DESeq2

    • Perform multidimensional scaling (MDS) to visualize similarities between samples

    • Cluster genes with similar expression patterns

  • Biological Interpretation:

    • Compare abcG22 mutant profiles to established developmental gene sets

    • Focus particularly on Gene set D, which contains 668 developmentally important genes identified in previous studies

    • Identify transcription factors affected by abcG22 mutation

    • Perform Gene Ontology and pathway enrichment analysis

Previous studies have shown that abcG22 mutants cluster with several other ABC transporter mutants (abcF2, abcG7, abcG10, and abcG22) based on their transcriptional profiles, with the most pronounced differences occurring at 12 and 18 hours of development . This suggests potential functional relationships between these transporters that could be further investigated.

What genetic relationships exist between abcG22 and other signaling pathways?

The genetic relationships between abcG22 and other signaling pathways remain incompletely characterized, but insights can be gained from studies of related transporters. In Arabidopsis, analysis of double mutants has revealed important genetic relationships:

  • ABA Signaling Pathway: In Arabidopsis, atabcg22 mutation enhances the water loss phenotype of srk2e/ost1 mutants (defective in ABA signaling in guard cells), suggesting additive or parallel functions .

  • ABA Biosynthesis Pathway: The atabcg22 mutation also enhances the phenotype of nced3 mutants (defective in ABA biosynthesis), indicating that AtABCG22 functions are additive to both ABA signaling and biosynthesis pathways .

For D. discoideum abcG22, similar double mutant approaches would be valuable for determining genetic interactions. Potential candidates for double mutant analysis include:

  • cAMP signaling components (pkaC, acaA)

  • Developmental regulators (gbfA, dimB)

  • Other ABC transporters showing similar transcriptional phenotypes (abcF2, abcG7, abcG10)

Based on transcriptional profiling studies, abcG22 mutants clustered with other ABC transporter mutants, suggesting potential functional relationships that could be tested through genetic interaction studies .

How might researchers resolve contradictions in abcG22 functional data?

When faced with contradictory findings regarding abcG22 function, researchers should consider the following systematic approach:

  • Experimental Validation:

    • Reproduce key experiments using standardized protocols

    • Ensure genetic background consistency by backcrossing mutant strains

    • Use complementation studies to confirm phenotypes are due to the specific abcG22 mutation

    • Employ multiple independent null mutants or CRISPR-generated mutants

  • Context-Dependent Function Analysis:

    • Test for condition-specific effects (nutrient levels, bacterial food source, temperature)

    • Examine developmental stage-specific functions

    • Consider cell-type specific expression and function

  • Technical Considerations:

    FactorPotential ImpactMitigation Strategy
    Genetic backgroundSecondary mutationsUse multiple independent mutants
    Growth conditionsVariable phenotypesStandardize protocols across labs
    Assay sensitivitySubtle phenotypes missedUse quantitative measurements
    Off-target effectsMisattribution of phenotypeInclude rescue experiments
  • Integrative Analysis:

    • Combine multiple data types (transcriptomic, phenotypic, biochemical)

    • Use systems biology approaches to place contradictory findings in broader context

    • Consider functional redundancy with other ABC transporters

The subtle phenotypes observed in most ABC transporter mutants in D. discoideum highlight the importance of sensitive assays and transcriptional profiling, which often reveals phenotypes not apparent through morphological examination alone .

What bioinformatic approaches are most useful for predicting abcG22 structure and substrate specificity?

To predict abcG22 structure and substrate specificity, researchers should employ a multi-faceted bioinformatic approach:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with characterized ABCG transporters

    • Identification of conserved motifs in nucleotide-binding domains and transmembrane regions

    • Analysis of substrate-binding region conservation across species

  • Structural Modeling:

    • Homology modeling based on crystallized ABC transporters (e.g., human ABCG2)

    • Molecular dynamics simulations to predict conformational changes

    • Substrate docking studies to identify potential binding pockets

  • Machine Learning Approaches:

    • Train algorithms on known ABC transporter-substrate relationships

    • Use feature extraction from protein sequences to predict substrate classes

    • Employ transfer learning from characterized transporters to abcG22

  • Evolutionary Analysis:

    • Phylogenetic reconstruction of ABCG family evolution

    • Identification of selection signatures in substrate-binding regions

    • Correlation of evolutionary changes with organism-specific substrates

The strong homology between DdABCG22 and AtABCG14 provides a starting point for structural predictions . Additionally, considering that plant and Dictyostelium ABCG transporters may share functional similarities despite evolutionary distance, comparative analysis across these systems could yield valuable insights into substrate specificity determinants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.