Recombinant Dictyostelium discoideum ABC transporter G family member 23 (abcG23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please clearly indicate your desired format when placing your order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery information, please contact your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms retain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type in mind, please specify it, and we will prioritize developing the requested tag.
Synonyms
abcG23; DDB_G0269026; ABC transporter G family member 23; ABC transporter ABCG.23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-701
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abcG23
Target Protein Sequence
MGDNIVINLNNVSRSYGNVKVIEKLNFTINKGTINSLIGSSGSGKTTILKTILGKLKQDD GIVQVFGKEPCGKGSEIPGSSVGYAPQDVCLYNEITIEETLSFFASIHRMPKDEYIKKRD SLVEILELPSLSKIISELSGGQQRRVSLATALIHSPKLLILDEPTVGVCPLVSSKIWEHL IFLTKNFGVTIIITTHYLQECRSCDNIFLLRNGRILESGPPNYLLSKYECSLLEDVYYKL CRGDEEISLQLIDSKNNEKINRDINTSIPLEFISNGANINNDDILISNTNKPIIKKDAKI YKERLSDFKNKLQIWFSHSITISIRKLTQMYRLKFPLVFEIISPSLLITLFFLAIGNVPH DLKFGIKNIDSGSLSGDFINALSDGNNIFNFIQINDTSNAIQMIESSDLWGLIDIPVNFT NGMINKLFNPLEKSFENSEMEIYMDLSNFQMNLMVDVQFQKAFNKIANDSGIKLLPTNFH AVYGDQNANFNWFLAPAMICIITYVHCMNFLSITFVREKNDGTRDRILLYGVSPVSNVLG HILAHIPILLVQFSIQLLIAVFAFGVPIKGNIVLIYLFFILINTVGMCQGILISLISKAE VDAVQLCLAIFICSLCMAGIIWPTEAIITFGWISNLVPTKWSGLALRGIMIKDLPFSHQH IWKSLIIIISYIIGTFSLIVISTPIGDRNFNFKKLFKRIKK
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the general structure of Dictyostelium discoideum abcG23?

As a member of the ABCG family in Dictyostelium discoideum, abcG23 is characterized by its unique domain arrangement where the nucleotide-binding domain (NBD) precedes the transmembrane domain (TMD) . This reverse configuration (NBD-TMD) distinguishes the ABCG family from other ABC transporters that typically exhibit a TMD-NBD arrangement. The NBD contains the conserved ATP-binding cassette with Walker A and B motifs separated by the LSGG sequence that is characteristic of ABC transporters . Based on the broader ABCG family in Dictyostelium, abcG23 likely exists as either a half-transporter with a single NBD-TMD unit that requires dimerization for function, or potentially as a full transporter with two NBD-TMD units fused in a single polypeptide .

How does abcG23 fit into the broader classification of ABC transporters in Dictyostelium discoideum?

The Dictyostelium discoideum genome contains approximately 68 ABC transporter genes divided into seven families (ABCA through ABCG) . AbcG23 belongs to the ABCG family, which in Dictyostelium includes both half-transporters and full transporters . This diverse representation contrasts with animals, which possess only half-transporters in the ABCG family, and fungi, which contain only full transporters . The ABCG family in Dictyostelium forms distinct evolutionary clusters, with some members showing closer homology to plant ABC transporters while others group with fungal homologs . Understanding abcG23's specific positioning within these clusters helps establish its evolutionary relationships and potential functional parallels with transporters in other organisms.

What is the presumed function of abcG23 based on its ABCG family membership?

While the specific substrates and physiological roles of abcG23 remain under investigation, its function can be inferred from known roles of the ABCG family members across species. As an ATP-driven transporter, abcG23 likely mediates the export of specific substrates across cellular membranes . ABCG transporters in various organisms have been implicated in the transport of lipids, sterols, and xenobiotics . The transport mechanism involves ATP binding at the NBD, which drives conformational changes between inward-facing (IF) and outward-facing (OF) states of the TMDs, ultimately facilitating substrate movement across the membrane . This conformational cycling between IF and OF states represents a dynamic equilibrium that can be modified by nucleotide binding and hydrolysis .

What are the optimal expression systems for producing recombinant abcG23 protein?

For successful expression of functional recombinant abcG23, several systems can be considered with specific advantages:

Expression SystemAdvantagesLimitationsYieldPurification Tags
E. coliRapid growth, inexpensive, high yieldPotential improper folding of membrane proteinsVariable (5-10 mg/L)His6, GST, MBP
Insect cellsPost-translational modifications, proper membrane insertionHigher cost, longer production timeModerate (2-5 mg/L)His6, FLAG
Mammalian cellsNative-like membrane environmentHighest cost, complex protocolsLow (0.5-2 mg/L)His6, FLAG, Twin-Strep
DictyosteliumNative environment, proper foldingSpecialized expertise requiredModerate (1-3 mg/L)His6, GFP fusion

When expressing abcG23, careful consideration of detergent selection for membrane extraction is crucial, with mild non-ionic detergents like DDM, LMNG, or GDN typically providing the best balance between protein stability and maintaining native conformation. Codon optimization based on the expression host and inclusion of chaperone co-expression strategies can significantly improve functional yield. For studies requiring properly folded and functional protein, the Dictyostelium expression system may provide advantages due to native cellular machinery for proper folding and post-translational modifications.

What methodologies are most effective for studying the transport mechanism of abcG23?

To elucidate the transport mechanism of abcG23, employing multiple complementary approaches is recommended:

  • Double Electron-Electron Resonance (DEER) spectroscopy can be used to monitor conformational changes between inward-facing and outward-facing states in the presence of various nucleotides, similar to studies on other ABC transporters . This technique allows observation of the conformational equilibrium under different conditions.

  • Reconstitution of purified abcG23 into proteoliposomes or nanodiscs facilitates transport assays with fluorescent or radioactively labeled substrates to directly measure transport activity and kinetics.

  • ATPase activity assays (coupled enzymatic assays or phosphate release measurements) can assess how substrate binding affects the rate of ATP hydrolysis, providing insights into the coupling between substrate transport and energy utilization.

  • Site-directed mutagenesis of key residues in the Walker A, Walker B, and signature LSGG motifs can help decipher the roles of specific amino acids in ATP binding, hydrolysis, and conformational coupling between NBDs and TMDs .

  • Cryo-electron microscopy has emerged as a powerful technique to capture different conformational states of ABC transporters and could be particularly valuable for visualizing the structural transitions of abcG23 during its transport cycle.

How can researchers effectively introduce mutations into abcG23 to study structure-function relationships?

For systematic investigation of structure-function relationships in abcG23, several mutation strategies should be considered:

  • Target the Walker A (GXXXXGK[S/T]) and Walker B (ΦΦΦΦD, where Φ is a hydrophobic residue) motifs to disrupt ATP binding and hydrolysis, respectively. Substitution of the conserved lysine in Walker A to arginine (K→R) typically preserves ATP binding but prevents hydrolysis, while mutation of the conserved aspartate in Walker B to asparagine (D→N) can trap the transporter in a pre-hydrolytic state .

  • Modify the signature LSGG sequence between Walker A and B motifs to investigate how ATP binding affects conformational changes between NBDs and TMDs .

  • In the ABCG family of Dictyostelium that clusters with fungal homologs, the conserved lysine in the Walker A motif of the first ABC domain is often replaced by cysteine . If abcG23 contains this substitution, reverting it to lysine could provide insights into the functional consequences of this evolutionary adaptation.

  • Utilize alanine-scanning mutagenesis of the predicted substrate-binding pocket within the TMDs to identify residues critical for substrate specificity.

  • For expression studies, incorporate a C-terminal GFP fusion to monitor protein localization and expression levels, with a TEV protease cleavage site to remove the tag for functional assays.

Creating stable Dictyostelium cell lines expressing these mutants, rather than transient expression, generally provides more consistent results for long-term functional studies.

How has abcG23 evolved compared to other ABCG transporters in Dictyostelium and other species?

The evolutionary history of abcG23 can be contextualized within the broader evolution of ABCG transporters, which display interesting phylogenetic patterns across species. In Dictyostelium, the ABCG family separates into two major groups of full transporters - one clustering with plant sequences and the other with fungal sequences . Additionally, Dictyostelium has multiple half-transporters in this family, most of which cluster together but with exceptions like ABCG.1 and ABCG.20 that group with Drosophila, Arabidopsis, and human homologs .

Interestingly, the ABCG family is thought to have arisen either from fusion of independent ABC and TM domains or from the central portion of a member of the A, B, or C family that included only the first ABC domain and the second TM domain . The ABC domains of the G family cluster with those of the A family, suggesting an ABCA gene as the most likely source of the original ABCG gene .

The presence of both half and full transporters in Dictyostelium's ABCG family, compared to exclusively half transporters in animals and full transporters in fungi, suggests that the ancestral state likely included both forms, with subsequent lineage-specific retention of one form or the other . Detailed phylogenetic analysis of abcG23 relative to these various clusters would provide insights into its specific evolutionary trajectory and potential functional relationships with transporters in other organisms.

What can comparative analysis of abcG23 with other ABC transporters tell us about its substrate specificity?

Comparative analysis with functionally characterized ABC transporters can provide valuable insights into potential substrates for abcG23. The substrate specificity of ABC transporters is primarily determined by the structure and amino acid composition of their transmembrane domains, which form the substrate-binding pocket.

By aligning the TMD sequences of abcG23 with those of well-characterized ABCG transporters from other organisms whose substrates are known (such as human ABCG2/BCRP, ABCG5/G8, or Drosophila white/brown/scarlet), researchers can identify conserved residues that might be involved in substrate recognition and binding. Additionally, creating chimeric proteins by swapping TMDs between abcG23 and characterized transporters can help define regions responsible for substrate specificity.

Homology modeling based on available crystal structures of related transporters, followed by molecular docking simulations with potential substrates, can further refine predictions about substrate preferences. These computational approaches, when combined with experimental transport assays using candidate substrates, provide a powerful strategy for delineating the substrate profile of abcG23.

How can single-molecule techniques be applied to study the conformational dynamics of abcG23?

Single-molecule techniques offer unprecedented insights into the real-time conformational dynamics of ABC transporters like abcG23, revealing transient intermediate states that may be obscured in ensemble measurements:

  • Single-molecule Förster Resonance Energy Transfer (smFRET) can be implemented by introducing fluorescent donor and acceptor pairs at strategic positions in the NBDs and/or TMDs of abcG23. This approach allows direct observation of conformational changes during the transport cycle with high temporal resolution. For optimal results, positioning FRET pairs at residues that undergo significant distance changes between the inward-facing and outward-facing conformations is crucial .

  • High-speed Atomic Force Microscopy (HS-AFM) can visualize conformational changes of individual abcG23 molecules reconstituted into lipid bilayers in response to substrate binding and ATP hydrolysis. This technique provides topographical information at near-physiological conditions without requiring protein labeling.

  • Single-molecule force spectroscopy using optical or magnetic tweezers can measure the mechanical forces associated with conformational transitions during the transport cycle, providing insights into the energetics of these conformational changes.

  • Combining these techniques with controlled introduction of ATP, non-hydrolyzable ATP analogs (AMP-PNP), or transition state analogs (beryllium fluoride or vanadate-trapped ADP) can dissect the specific conformational effects of nucleotide binding versus hydrolysis .

The challenge with these approaches lies in achieving sufficient signal-to-noise ratios and in the careful design of labeling strategies that minimize functional perturbation of the transporter.

What approaches can be used to identify the physiological substrates of abcG23 in Dictyostelium?

Identifying the physiological substrates of abcG23 requires a multi-faceted approach:

  • Gene knockout or CRISPR-mediated disruption of abcG23 in Dictyostelium, followed by metabolomic profiling using LC-MS/MS to identify compounds that accumulate in mutant cells compared to wild-type. This untargeted approach can reveal unexpected substrates.

  • Transcriptomic analysis comparing wild-type and abcG23-deficient cells under various stress conditions to identify pathways that are differentially regulated, potentially pointing to metabolic processes involving abcG23 substrates.

  • In vitro transport assays using inside-out membrane vesicles prepared from cells overexpressing abcG23, or reconstituted proteoliposomes containing purified protein, to test transport of candidate substrates based on known substrates of related transporters.

  • Photoaffinity labeling with substrate analogs containing photoactivatable groups, followed by mass spectrometry identification of binding sites, can provide direct evidence of substrate interactions.

  • Fluorescent substrate analogs combined with live-cell imaging can visualize transport in real-time and confirm cellular localization of abcG23 activity.

Integration of these approaches, particularly correlating in vitro transport data with phenotypic consequences of abcG23 deficiency, provides the most robust strategy for substrate identification.

How does the ATP hydrolysis cycle couple to conformational changes in abcG23?

The coupling between ATP hydrolysis and conformational changes in ABC transporters like abcG23 involves a complex sequence of molecular events that power substrate translocation. Based on studies of related transporters, this process likely follows a cycle where:

  • In the absence of nucleotides, abcG23 predominantly adopts an inward-facing (IF) conformation with separated NBDs, although some heterodimeric ABC exporters show only partial NBD separation in this state .

  • ATP binding to the NBDs promotes their dimerization, which induces conformational changes in the TMDs that shift the transporter toward an outward-facing (OF) state. Importantly, ATP binding alone may be sufficient to partially populate the OF state, as demonstrated in TM287/288 .

  • Commitment to ATP hydrolysis further stabilizes the OF conformation, with pre- or post-hydrolytic states (mimicked by beryllium fluoride or vanadate trapping of ADP) showing pronounced conformational shifts .

  • After ATP hydrolysis and phosphate release, the NBDs disengage asymmetrically and the transporter returns to the IF state, completing the cycle .

Experimental approaches to study this coupling mechanism include:

  • EPR spectroscopy techniques like DEER to monitor distance changes between specific residues during the transport cycle .

  • Mutations in Walker A (K→A), Walker B (E→Q), or signature motifs to trap the transporter in different states of the ATP hydrolysis cycle .

  • Analysis of how these mutations and different nucleotides (ATP, ADP, non-hydrolyzable analogs) affect both ATPase activity and substrate transport rates to establish the correlation between these processes.

These studies would reveal whether abcG23 follows the ATP-switch model where ATP binding drives the major conformational change, or whether it requires hydrolysis for the power stroke, as debated for different ABC transporters .

What are the major challenges in achieving high-yield purification of functional abcG23?

Purifying functional membrane proteins like abcG23 presents several technical challenges:

ChallengeCauseSolution Strategies
Low expression levelsToxicity to host cells, inefficient membrane insertionUse inducible expression systems, lower induction temperatures (16-25°C), optimize codon usage
Protein instabilityDetergent-induced destabilization, lack of stabilizing lipidsScreen multiple detergents, include lipids during purification, use styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction
AggregationHydrophobic interactions between exposed transmembrane regionsAdd glycerol (10-20%) to buffers, include mild solubilizing agents like arginine
Loss of ATP binding/hydrolysis activityDetergent effects on NBD conformationInclude nucleotides during purification, use ATP analogs to stabilize specific conformations
HeterogeneityMultiple conformational statesUse nanobodies or conformation-specific antibodies to lock specific states

Additionally, the functional reconstitution of purified abcG23 into proteoliposomes or nanodiscs requires careful optimization of lipid composition to match the native Dictyostelium membrane environment. For challenging membrane proteins like ABC transporters, new approaches such as SMALPs that preserve the native lipid environment during extraction and purification have shown promising results and may be particularly valuable for maintaining abcG23 functionality.

How can researchers reconcile contradictory data when studying abcG23 conformational states?

When faced with apparently contradictory data regarding abcG23 conformational states, researchers should consider several potential sources of discrepancy:

  • Technique-specific biases: Different structural techniques (X-ray crystallography, cryo-EM, EPR, smFRET) may capture different states due to their specific experimental conditions. For example, crystal structures typically represent energy minima, while EPR and DEER measurements can detect equilibrium distributions between multiple conformations that coexist in solution .

  • Environmental factors: The lipid environment, temperature, pH, and ionic strength can significantly affect conformational equilibria. Studies of the heterodimeric ABC exporter TM287/288 demonstrated that at physiologically high temperatures, the NBDs disengage asymmetrically .

  • Nucleotide state: The presence of different nucleotides (ATP, ADP, ATP analogs) and transition state mimics (beryllium fluoride, vanadate) can dramatically shift conformational equilibria . For example, ATP binding may be sufficient to partially populate the outward-facing state, while nucleotide trapping in pre- or post-hydrolytic states might be required for more pronounced conformational shifts .

To reconcile contradictory data:

  • Perform comparative studies using multiple techniques under identical conditions.

  • Systematically vary conditions to map the "conformational landscape" rather than seeking a single "correct" state.

  • Consider that multiple conformations may coexist in equilibrium with the relative populations determined by experimental conditions .

  • Use nucleotide analogs and mutations systematically to trap specific states in the transport cycle.

This approach acknowledges that apparent contradictions may reflect genuine differences in conformational equilibria under different experimental conditions rather than experimental artifacts.

What emerging technologies could advance our understanding of abcG23 function and regulation?

Several cutting-edge technologies hold promise for deeper insights into abcG23:

  • Cryo-electron tomography of whole Dictyostelium cells could visualize abcG23 in its native membrane environment, potentially revealing interactions with other cellular components that might regulate its function.

  • Time-resolved structural methods, such as time-resolved cryo-EM and X-ray free-electron laser (XFEL) crystallography, could capture transient conformational states during the transport cycle that are missed by conventional structural approaches.

  • Native mass spectrometry of intact membrane protein complexes can determine precise subunit stoichiometry and detect binding of lipids, nucleotides, and substrate molecules under near-native conditions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational dynamics and solvent accessibility changes during the transport cycle, providing complementary information to traditional structural techniques.

  • In-cell NMR and electron paramagnetic resonance (EPR) spectroscopy could monitor abcG23 conformational changes within living Dictyostelium cells, bridging the gap between in vitro and in vivo studies.

  • CRISPR-based screening approaches combined with phenotypic assays could identify genetic interactions with abcG23, revealing potential regulatory pathways and functional networks.

The integration of these technologies, particularly those that maintain native contexts and capture dynamic processes, will be crucial for developing a comprehensive understanding of abcG23 function within the complex cellular environment of Dictyostelium.

How can systems biology approaches enhance our understanding of abcG23's role in Dictyostelium physiology?

Systems biology offers powerful frameworks to place abcG23 within broader cellular networks:

  • Multi-omics integration: Combining transcriptomics, proteomics, metabolomics, and lipidomics data from wild-type and abcG23-deficient Dictyostelium under various conditions can reveal affected pathways and networks that might not be apparent from single-omics approaches.

  • Network inference algorithms can identify genes whose expression patterns correlate with abcG23 across diverse conditions, suggesting functional relationships or co-regulation.

  • Flux balance analysis incorporating abcG23 transport activities can predict metabolic consequences of transporter dysfunction and generate testable hypotheses about its physiological role.

  • Agent-based modeling of Dictyostelium development incorporating abcG23 function could predict phenotypic consequences of transporter manipulation across different developmental stages.

  • Machine learning approaches trained on multi-omics datasets can potentially predict novel substrates or regulatory interactions for abcG23 based on patterns identified in known ABC transporter systems.

These systems-level approaches are particularly valuable for understanding ABC transporters like abcG23, whose functions often intersect with multiple cellular processes and whose phenotypic effects may be subtle or context-dependent due to functional redundancy with other transporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.